KEGG   Candidatus Pelagibacter ubique: SAR11_1044Help
Entry
SAR11_1044        CDS       T00257                                 

Gene name
ribA
Definition
GTP cyclohydrolase II (EC:3.5.4.25)
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SAR11_1044 (ribA)
Enzymes [BR:pub01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SAR11_1044 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SAR11_1044 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1015501..1016601)
Genome map
AA seq 366 aa AA seqDB search
MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLIC
LALDSVQAKRLNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRAKTIKIASKKNAN
KKDIVSPGHVFPIIAKDGGVLVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQD
LFDFANKHNLKIGKIEDLIAYRLKKEKLIKLKKQSDIKVKNQKYKIRIYENLLDGSEHFA
LIKGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLNYFKKFNNCVLVFIKDTNLKS
VTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKVIGLEGYDIKI
TKQEII
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaataattatgcatccattgaaagtataataaatatcgcaaagaaaggtggt
atgttcatcttagttgatgatgagaaaagagaaaacgaaggagacttaataatatcaacc
actgactcaagcgctaaaaatataaattttatggcaaaatatggtcgtggattaatttgt
ctggcgctagatagtgtacaagcaaagcgattaaatttatctttgatgtcaccaatcaat
caatcaaggaataaaactgcatttacaatttctattgaagcaaaaaaaggaataacaaca
ggtatctcagcaaaagatagagcaaagacaattaaaattgcttcaaaaaaaaatgcaaat
aagaaagacatagtttcacctggacatgtttttccaattattgcgaaagacggcggcgtt
ttagtaagagctggtcacacagaagcctctgttgatatttcaaaacttgctaaaaaaaat
aactctgcagttatttgtgaaataatgaatgaagatgggacaatggccaaaggccaagat
ttatttgattttgcaaacaaacataatttaaagataggtaaaattgaagatcttattgct
tatcgtttaaaaaaagaaaaattaattaaacttaaaaaacaatcagatattaaagtaaaa
aatcaaaaatataaaattcgaatttatgaaaaccttttagatggatctgagcattttgct
ttgattaaaggaaatattaaaaaagggataataccaagagttagagtaatttcttctaac
gtagttcaaaattatttaatcaatcaacaattaccaaattcatttgataaaactttaaat
tattttaagaaatttaataactgtgttttagtttttataaaagatacaaatttaaaatct
gttacacaaacacttaaggattataaaaacaaaaatttctataaaaaaggaaatgataag
cttataagaaattatggtattggtgctcaaataattaaagatttaaagattaaaaatatg
atattaattactaagtctcttaaaaaagttattggtttggaaggttatgatataaagatt
actaaacaggaaattatttaa

DBGET integrated database retrieval system