KEGG   Candidatus Pelagibacter ubique: SAR11_1080Help
Entry
SAR11_1080        CDS       T00257                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAR11_1080 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAR11_1080 (pyrB)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SAR11_1080 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046091..1047032
Genome map
AA seq 313 aa AA seqDB search
MATKINKAIKISQKHLLGIQDLSINDVNFILEEAKSFIKLNQSKNKRLNVLSGKTQINLF
FEPSTRTQSSFELAGKRLGADVMSMNMANSAIKKGETLIDTAMTLNAMHPDIIVIRHQDS
GACNLLSQKVNCAVLNAGDGSREHPTQALLDALTIINRKKKIEGLRVAICGDITHSRVAR
SNIYLLNMLGAEVNIIAPSNLMPKEIEKFGVNTFTDMKKGLKDCDIVMMLRLQNERMTSS
FLSSNREYYEYYGLTPDKLAHAKDDALIMHPGPMNRGIEIDTKLADDINRSVIKEQVELG
VAVRMACLKIFCE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaaaataaataaagctattaaaatctctcaaaaacacctcctaggtattcaa
gatctatcaattaatgatgttaattttattttagaagaagctaaaagtttcatcaaatta
aatcaaagtaaaaacaaaagattaaatgtcttaagtggtaaaactcaaattaatttgttt
tttgaaccttcaacaagaacacagagttcatttgaattagctggaaaaagattaggtgca
gatgttatgtcaatgaatatggcaaattcagctattaagaaaggtgaaacactcatagat
actgcaatgactttaaatgcaatgcatcctgatataattgtaattagacaccaagattca
ggtgcgtgtaatcttttatctcaaaaagtaaattgcgcagtacttaatgctggagatgga
agccgtgaacaccctactcaagctttactagatgctttaacaattataaatcgaaaaaaa
aaaattgaaggtttaagagttgcgatttgtggtgacataactcattcacgtgttgcaaga
tcaaatatttatcttttaaatatgttaggtgcagaagttaacattattgcaccatcaaat
ttaatgccaaaagaaatagaaaagtttggggttaatacttttacagatatgaaaaaaggt
ttgaaagattgtgatattgtaatgatgttaaggttacaaaatgaaaggatgactagttct
ttcttgtcttctaatagagagtactatgaatattatggactaactccagataaacttgct
catgcaaaagatgatgctttaattatgcatccaggccctatgaatagagggatcgaaatt
gacactaaattagcagatgacattaacagaagcgtaattaaggaacaggttgaactaggt
gttgcagtaagaatggcttgtttaaaaatattttgtgaataa

DBGET integrated database retrieval system