KEGG   Candidatus Pelagibacter ubique: SAR11_1080Help
Entry
SAR11_1080        CDS       T00257                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pub00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pub00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046091..1047032
Genome map
AA seq 313 aa AA seqDB search
MATKINKAIKISQKHLLGIQDLSINDVNFILEEAKSFIKLNQSKNKRLNVLSGKTQINLF
FEPSTRTQSSFELAGKRLGADVMSMNMANSAIKKGETLIDTAMTLNAMHPDIIVIRHQDS
GACNLLSQKVNCAVLNAGDGSREHPTQALLDALTIINRKKKIEGLRVAICGDITHSRVAR
SNIYLLNMLGAEVNIIAPSNLMPKEIEKFGVNTFTDMKKGLKDCDIVMMLRLQNERMTSS
FLSSNREYYEYYGLTPDKLAHAKDDALIMHPGPMNRGIEIDTKLADDINRSVIKEQVELG
VAVRMACLKIFCE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaaaataaataaagctattaaaatctctcaaaaacacctcctaggtattcaa
gatctatcaattaatgatgttaattttattttagaagaagctaaaagtttcatcaaatta
aatcaaagtaaaaacaaaagattaaatgtcttaagtggtaaaactcaaattaatttgttt
tttgaaccttcaacaagaacacagagttcatttgaattagctggaaaaagattaggtgca
gatgttatgtcaatgaatatggcaaattcagctattaagaaaggtgaaacactcatagat
actgcaatgactttaaatgcaatgcatcctgatataattgtaattagacaccaagattca
ggtgcgtgtaatcttttatctcaaaaagtaaattgcgcagtacttaatgctggagatgga
agccgtgaacaccctactcaagctttactagatgctttaacaattataaatcgaaaaaaa
aaaattgaaggtttaagagttgcgatttgtggtgacataactcattcacgtgttgcaaga
tcaaatatttatcttttaaatatgttaggtgcagaagttaacattattgcaccatcaaat
ttaatgccaaaagaaatagaaaagtttggggttaatacttttacagatatgaaaaaaggt
ttgaaagattgtgatattgtaatgatgttaaggttacaaaatgaaaggatgactagttct
ttcttgtcttctaatagagagtactatgaatattatggactaactccagataaacttgct
catgcaaaagatgatgctttaattatgcatccaggccctatgaatagagggatcgaaatt
gacactaaattagcagatgacattaacagaagcgtaattaaggaacaggttgaactaggt
gttgcagtaagaatggcttgtttaaaaatattttgtgaataa

DBGET integrated database retrieval system