KEGG   Candidatus Pelagibacter ubique: SAR11_1087Help
Entry
SAR11_1087        CDS       T00257                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAR11_1087 (galU)
   00052 Galactose metabolism
    SAR11_1087 (galU)
   00500 Starch and sucrose metabolism
    SAR11_1087 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11_1087 (galU)
Enzymes [BR:pub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAR11_1087 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1053581..1054396)
Genome map
AA seq 271 aa AA seqDB search
MIKQAIIPLAGLGTRLLPLTSVFAKELLPINGKPGLEYIIEECIEAGIKEIVFIISKKKL
MIKKYFYNDKFYKDIIKKKNDPKIIKEYKKILKYKKMIKFVFQDKPLGTGDAVYKTKKFI
TDKYFLMLLPDDLIIKKNCSKSMIAVHNKFKASVMASMKVNKNDVSRWGIYNIRKKIDKN
NFIINNVVEKPSIKTSPSNNAVIGRYILPKTIFSKLKSLKPGKSGEFHITDAIQALIEDD
NQFIGHNFSGKYLDCGTMKGYIKSTLEISKQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaagctataattcctttagctggtcttggtactagactactaccactaaca
agtgtttttgctaaagagcttctacctattaatggaaaaccaggcttagaatatattatc
gaagaatgtattgaggctggtattaaggaaattgtatttattatttctaaaaaaaaattg
atgataaagaaatatttttataatgataaattttacaaagatattatcaagaaaaaaaat
gatccaaaaattatcaaagaatataaaaaaattctcaaatataaaaaaatgattaaattt
gtttttcaagacaaaccattaggaactggtgatgctgtctacaagactaaaaaatttatt
acagataaatattttttaatgttattacctgatgatttgataattaaaaaaaactgctct
aagtcaatgattgccgtgcataataaatttaaagcatcagttatggcaagtatgaaggtt
aataaaaatgatgtatctaggtggggtatctacaacatcagaaaaaaaattgataaaaat
aattttattataaataatgttgttgaaaaaccttctataaaaacttcaccttctaataat
gctgtaataggaagatatatattacctaaaacaattttttctaaattaaaatctcttaaa
ccaggtaaaagtggtgaatttcatatcactgacgctatccaagctttaatagaagatgat
aatcaatttattggtcacaatttttcaggtaaatacttagattgtggaacaatgaaaggt
tatattaaatcaacgttggagatttctaaacaatga

DBGET integrated database retrieval system