KEGG   Candidatus Pelagibacter ubique: SAR11_1160Help
Entry
SAR11_1160        CDS       T00257                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_1160 (manB)
   00030 Pentose phosphate pathway
    SAR11_1160 (manB)
   00051 Fructose and mannose metabolism
    SAR11_1160 (manB)
   00052 Galactose metabolism
    SAR11_1160 (manB)
   00500 Starch and sucrose metabolism
    SAR11_1160 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11_1160 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    SAR11_1160 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAR11_1160 (manB)
Enzymes [BR:pub01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SAR11_1160 (manB)
    5.4.2.8  phosphomannomutase
     SAR11_1160 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115724..1117178
Genome map
AA seq 484 aa AA seqDB search
MTTNLKIDPYGFREYDARWLYEKDINQLGIENLGRGLGTQIIKHTKKTNPRVIVGHDYRS
YSEEIKSALKKGLLSTGCNVEDIGLSLSPTVYFAQFNLDADAVAMVTASHNENGWTGVKM
GIKKGLTHAPEEMKELKEITLNENFIKGEGNEKHIDGFQQIYKNDLINKNKITKKIKAVV
ACGNGTAGIFAPEILRGIGCEVIELDCDLDWTFPKYNPNPEDLEMLHAIAKAVKDNNADI
GFGFDGDGDRVGVIDNTGDEIFSDKIGLLIARNLSKTHKNSKFIVDVKSTGLYATDKVLS
DNNCETIYWKTGHSHIKRKVNTEKALAGFEKSGHFFFNQPLGFGYDDGINSAIHVCHLLD
NQNKSMNEIIKELPNTFQTPTMAPFCKDEEKYQVVEDLVKQVNAIKDNKTKIDDQEISEV
LTVNGIRFSFKDGSWGLIRASSNKPSLVIVTESPTSDERKKKIFDFIDDLLQKTGKVGEY
DQKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaatttaaaaatagatccatatggcttcagagagtatgacgcgaggtggttg
tacgagaaggacataaaccaactcggaatagagaatctaggaagaggtttaggaactcaa
attataaaacatacaaaaaaaactaatccaagagtaattgttggtcatgattatagatct
tacagtgaagaaataaaatctgctcttaaaaaaggactactttcaactggatgtaatgtt
gaagacataggtttatcattatcccctactgtttattttgcacaatttaatttagatgca
gatgctgttgcaatggtaactgctagtcataatgaaaatggttggactggagttaaaatg
ggtatcaaaaaaggtttaacccatgcaccagaagagatgaaagaattaaaagaaattacc
ttaaatgaaaatttcataaaaggtgaaggtaatgagaaacacatagatggttttcagcaa
atttataaaaatgatttaataaataaaaataaaataacaaaaaaaattaaagcagttgtt
gcatgtggtaatggtaccgctggaatatttgcccctgaaattttaagaggtattggttgt
gaggtaatagaactcgattgtgatcttgattggacttttccaaaatataatccaaatcca
gaagatttagagatgttacatgcaattgcaaaagctgtaaaagataataacgctgatatt
ggtttcggttttgatggtgatggcgatagagttggtgtaattgataatacaggggatgaa
atattttcagataaaattggattattgatcgcaagaaatttatctaaaactcataaaaat
tctaaatttatagttgatgtaaaatcaactggattgtacgcaactgataaagttttaagt
gataataactgtgaaaccatttattggaagacaggtcactcacacattaaaagaaaagtt
aatactgaaaaagcattagctggatttgagaaaagtggtcattttttctttaaccaacct
ttaggttttggttatgatgatggaataaattctgcaattcatgtgtgccatttattagat
aatcaaaataaatctatgaatgaaattataaaagaattacctaatacttttcaaacccca
acaatggctcccttttgtaaggatgaagagaaatatcaagtagttgaagatttagttaag
caagtaaacgctattaaagataataaaactaaaattgatgaccaagagattagtgaagtc
ttaacagttaatggtatcaggttttcttttaaagatggatcatggggtttaattagagcc
tcatcaaataaaccatcattagttattgtaaccgaaagcccaacatcagatgagagaaag
aaaaagatctttgattttattgatgaccttttacaaaaaactggcaaagttggtgaatat
gatcaaaaaatataa

DBGET integrated database retrieval system