KEGG   Candidatus Pelagibacter ubique: SAR11_1160Help
Entry
SAR11_1160        CDS       T00257                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00010  Glycolysis / Gluconeogenesis
pub00030  Pentose phosphate pathway
pub00051  Fructose and mannose metabolism
pub00052  Galactose metabolism
pub00230  Purine metabolism
pub00500  Starch and sucrose metabolism
pub00520  Amino sugar and nucleotide sugar metabolism
pub00521  Streptomycin biosynthesis
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_1160 (manB)
   00030 Pentose phosphate pathway
    SAR11_1160 (manB)
   00051 Fructose and mannose metabolism
    SAR11_1160 (manB)
   00052 Galactose metabolism
    SAR11_1160 (manB)
   00500 Starch and sucrose metabolism
    SAR11_1160 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    SAR11_1160 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    SAR11_1160 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAR11_1160 (manB)
Enzymes [BR:pub01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SAR11_1160 (manB)
    5.4.2.8  phosphomannomutase
     SAR11_1160 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Arb1
Motif
Other DBs
NCBI-ProteinID: AAZ21963
UniProt: Q4FLH5
Position
1115724..1117178
Genome map
AA seq 484 aa AA seqDB search
MTTNLKIDPYGFREYDARWLYEKDINQLGIENLGRGLGTQIIKHTKKTNPRVIVGHDYRS
YSEEIKSALKKGLLSTGCNVEDIGLSLSPTVYFAQFNLDADAVAMVTASHNENGWTGVKM
GIKKGLTHAPEEMKELKEITLNENFIKGEGNEKHIDGFQQIYKNDLINKNKITKKIKAVV
ACGNGTAGIFAPEILRGIGCEVIELDCDLDWTFPKYNPNPEDLEMLHAIAKAVKDNNADI
GFGFDGDGDRVGVIDNTGDEIFSDKIGLLIARNLSKTHKNSKFIVDVKSTGLYATDKVLS
DNNCETIYWKTGHSHIKRKVNTEKALAGFEKSGHFFFNQPLGFGYDDGINSAIHVCHLLD
NQNKSMNEIIKELPNTFQTPTMAPFCKDEEKYQVVEDLVKQVNAIKDNKTKIDDQEISEV
LTVNGIRFSFKDGSWGLIRASSNKPSLVIVTESPTSDERKKKIFDFIDDLLQKTGKVGEY
DQKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaatttaaaaatagatccatatggcttcagagagtatgacgcgaggtggttg
tacgagaaggacataaaccaactcggaatagagaatctaggaagaggtttaggaactcaa
attataaaacatacaaaaaaaactaatccaagagtaattgttggtcatgattatagatct
tacagtgaagaaataaaatctgctcttaaaaaaggactactttcaactggatgtaatgtt
gaagacataggtttatcattatcccctactgtttattttgcacaatttaatttagatgca
gatgctgttgcaatggtaactgctagtcataatgaaaatggttggactggagttaaaatg
ggtatcaaaaaaggtttaacccatgcaccagaagagatgaaagaattaaaagaaattacc
ttaaatgaaaatttcataaaaggtgaaggtaatgagaaacacatagatggttttcagcaa
atttataaaaatgatttaataaataaaaataaaataacaaaaaaaattaaagcagttgtt
gcatgtggtaatggtaccgctggaatatttgcccctgaaattttaagaggtattggttgt
gaggtaatagaactcgattgtgatcttgattggacttttccaaaatataatccaaatcca
gaagatttagagatgttacatgcaattgcaaaagctgtaaaagataataacgctgatatt
ggtttcggttttgatggtgatggcgatagagttggtgtaattgataatacaggggatgaa
atattttcagataaaattggattattgatcgcaagaaatttatctaaaactcataaaaat
tctaaatttatagttgatgtaaaatcaactggattgtacgcaactgataaagttttaagt
gataataactgtgaaaccatttattggaagacaggtcactcacacattaaaagaaaagtt
aatactgaaaaagcattagctggatttgagaaaagtggtcattttttctttaaccaacct
ttaggttttggttatgatgatggaataaattctgcaattcatgtgtgccatttattagat
aatcaaaataaatctatgaatgaaattataaaagaattacctaatacttttcaaacccca
acaatggctcccttttgtaaggatgaagagaaatatcaagtagttgaagatttagttaag
caagtaaacgctattaaagataataaaactaaaattgatgaccaagagattagtgaagtc
ttaacagttaatggtatcaggttttcttttaaagatggatcatggggtttaattagagcc
tcatcaaataaaccatcattagttattgtaaccgaaagcccaacatcagatgagagaaag
aaaaagatctttgattttattgatgaccttttacaaaaaactggcaaagttggtgaatat
gatcaaaaaatataa

DBGET integrated database retrieval system