KEGG   Candidatus Pelagibacter ubique: SAR11_1244Help
Entry
SAR11_1244        CDS       T00257                                 

Gene name
yhdH
Definition
zinc-binding alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAR11_1244 (yhdH)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_1244 (yhdH)
  Lipid metabolism
   00071 Fatty acid degradation
    SAR11_1244 (yhdH)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAR11_1244 (yhdH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAR11_1244 (yhdH)
   00626 Naphthalene degradation
    SAR11_1244 (yhdH)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAR11_1244 (yhdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1186325..1187326)
Genome map
AA seq 333 aa AA seqDB search
MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKE
FPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDI
SSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYD
VTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTR
DNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLE
KSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataattttaaagcactagttgtcaatcaagaaagtgaaaattttacacgagaa
gtaaaatcaatagataaatcatttttaaaacatggcgatgtacttgttcaagtagattat
tcagacttaaactataaagatgcacttattttaaataatggggcaaaattagtaaaagaa
tttccacatatcccaggaattgatttcgcaggcactgttttagaaagtgataattctaaa
tttataaaaggggatgaagtaatccttacaggttggagagttggcgaaatttactttggt
ggctattctcagtttgctaaagttaatggagattacttagttaaaaaaccaaaagatatc
tcatctaaacaagcaatgatcttagggactgctggattaacagcattgttatgttctttt
gcaatcaaagctagagaagaacttttgttaggtgaaaaagtaaaagatgttttagttact
ggtgcatccggtggtgttggaagtattgcagtgatgattttaaataaatttggttatgat
gttacagctgttactggaaaggcagaaaatgaaaaatatttaagatcattaggcgctaaa
aatataataaataaagcagatttagataaagacgctagaccattagacaaaggtttatgg
gacggtgttgttgatactgttggtggaaagatacttgctaatgcgcttgcacaaacaaga
gacaatggaattgttgcagcctgtggaaacgcctctgattataaattaaatacaacagtt
atgccttttattattagaggtgttaaactttggggaattaactcggttacagcatcgatt
aaaagaagggagtttgtttggaatgaagttaaaagtcttattgattttgaacaattagaa
aaatcaattaaaactgtgagtttagaagatttaatagatatatatccgaaaatgctaaaa
ggtgagacatctggacgatatattgttgatcttaataaataa

DBGET integrated database retrieval system