KEGG   Candidatus Pelagibacter ubique: SAR11_1244Help
Entry
SAR11_1244        CDS       T00257                                 

Gene name
yhdH
Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00010  Glycolysis / Gluconeogenesis
pub00071  Fatty acid degradation
pub00350  Tyrosine metabolism
pub00625  Chloroalkane and chloroalkene degradation
pub00626  Naphthalene degradation
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01130  Biosynthesis of antibiotics
pub01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_1244 (yhdH)
  Lipid metabolism
   00071 Fatty acid degradation
    SAR11_1244 (yhdH)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAR11_1244 (yhdH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAR11_1244 (yhdH)
   00626 Naphthalene degradation
    SAR11_1244 (yhdH)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAR11_1244 (yhdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Epimerase ADH_zinc_N_2 adh_short NmrA Semialdhyde_dh Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AAZ22048
UniProt: Q4FL90
Position
complement(1186325..1187326)
Genome map
AA seq 333 aa AA seqDB search
MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKE
FPHIPGIDFAGTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDI
SSKQAMILGTAGLTALLCSFAIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYD
VTAVTGKAENEKYLRSLGAKNIINKADLDKDARPLDKGLWDGVVDTVGGKILANALAQTR
DNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASIKRREFVWNEVKSLIDFEQLE
KSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataattttaaagcactagttgtcaatcaagaaagtgaaaattttacacgagaa
gtaaaatcaatagataaatcatttttaaaacatggcgatgtacttgttcaagtagattat
tcagacttaaactataaagatgcacttattttaaataatggggcaaaattagtaaaagaa
tttccacatatcccaggaattgatttcgcaggcactgttttagaaagtgataattctaaa
tttataaaaggggatgaagtaatccttacaggttggagagttggcgaaatttactttggt
ggctattctcagtttgctaaagttaatggagattacttagttaaaaaaccaaaagatatc
tcatctaaacaagcaatgatcttagggactgctggattaacagcattgttatgttctttt
gcaatcaaagctagagaagaacttttgttaggtgaaaaagtaaaagatgttttagttact
ggtgcatccggtggtgttggaagtattgcagtgatgattttaaataaatttggttatgat
gttacagctgttactggaaaggcagaaaatgaaaaatatttaagatcattaggcgctaaa
aatataataaataaagcagatttagataaagacgctagaccattagacaaaggtttatgg
gacggtgttgttgatactgttggtggaaagatacttgctaatgcgcttgcacaaacaaga
gacaatggaattgttgcagcctgtggaaacgcctctgattataaattaaatacaacagtt
atgccttttattattagaggtgttaaactttggggaattaactcggttacagcatcgatt
aaaagaagggagtttgtttggaatgaagttaaaagtcttattgattttgaacaattagaa
aaatcaattaaaactgtgagtttagaagatttaatagatatatatccgaaaatgctaaaa
ggtgagacatctggacgatatattgttgatcttaataaataa

DBGET integrated database retrieval system