KEGG   Candidatus Pelagibacter ubique: SAR11_1287Help
Entry
SAR11_1287        CDS       T00257                                 

Definition
iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pub00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAR11_1287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR11_1287
  Lipid metabolism
   00071 Fatty acid degradation
    SAR11_1287
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAR11_1287
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAR11_1287
   00626 Naphthalene degradation
    SAR11_1287
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAR11_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1221431..1222597)
Genome map
AA seq 388 aa AA seqDB search
MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGI
IAALYSNVVGNPTGTNVNEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDF
EDVGDNWTKANSDKIAPIIAVPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVIL
DPILTVGLPAKMTAATGMDALAHNLEAYCAPGYHPMADGIALEGMRLIDKWLLEAVSNGS
NIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIHHGLSNAIFMPYVLTFNKDVI
ENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDIDRLSKMALADP
STGGNPKKLTEDDMRIMYQNSMTGELFK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatacaactggaattatcctactacaatgtgggtaggtgaaaatagaattaat
gatgttgcttcagcatgtaaaaatttaaacattaaaaagccactgcttgttactgataat
ggattagctcaatcagttattgttaaaaacactttatcgattttaaaagagggtggaatt
attgcagcattatattcaaatgttgttggtaacccaactggcacgaatgttaatgaaggt
gctgattattataaaaaaaacaattgtgatggtgttattgcgtttggaggtggtagtggt
ttagatgttggtaaagcagttgcttttatgtcaggtcaaaatctacctatttgggatttc
gaagatgttggagataattggactaaagcaaactctgataagattgctcccattattgca
gtacctactactgcgggcactggttctgaaactggcagagcatcagtaatattaaatgaa
gaaacaggcgtgaaaaatattatttttcatccaaaatttttaccatcaatagttatttta
gatccaattttaacagttggattaccagcaaaaatgactgcagcaactggaatggatgca
ctagcacataatttagaagcctattgtgcaccaggctatcatccgatggcagatggaatt
gctttagaaggaatgagattaattgataagtggctattagaagctgttagcaatggatct
aatattgaagcaagaatgaatatgttaacagcagctagtatgggctcaactgcatttcaa
aaaggactaggagcaattcattctctaagtcaccctgtcaatgcattaaataatattcat
cacggtttatctaatgcaatatttatgccttacgtgttaactttcaacaaagatgtaatt
gaaaataagataattaaaatttgtgactatttagaacttaaagacagatcttttgatggt
tttgttaactgggttttagatttaagaaaaaaacttgatatgcctcataaattatcagaa
gtgattgatgaaaaagattttgatattgatagattatcaaaaatggctttagcagaccca
tctactggaggaaatccaaaaaaattaactgaggatgatatgaggataatgtaccagaac
agtatgacaggtgaattgtttaaatga

DBGET integrated database retrieval system