KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0082Help
Entry
NT08PM_0082       CDS       T02057                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Brite
Enzymes [BR:pul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     NT08PM_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
61378..61908
Genome map
AA seq 176 aa AA seqDB search
MKHVKKITACSVAMIIAVVMSDHSTEIRTSERGLEIIGNAEGCAREPYRCPADVLTVGIG
STELSGLPIERKRYSDEEIAKRWVNDIKVAEKCVNNWASGKNLPQSTFEAAVSITFNVGC
SKLKYSTLFKHAKNGDIQAMCDQFPRWKYANGKVLRGLEIRRQKERELCLADLHKS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgttaagaagataacggcttgttctgttgcaatgattatcgctgttgtcatg
tccgatcactcaactgagattcgcaccagtgagcgtggactagaaatcattggtaatgcc
gaggggtgcgcacgtgaaccttatagatgtcctgctgacgttctaacagttggtattggc
tccacggaattaagcggactacctattgaacgtaaaagatattcagatgaagaaatagct
aaacgttgggtaaatgacatcaaagtggctgaaaaatgcgttaataactgggcaagtgga
aagaacttaccgcaaagtacatttgaggcagcggtatcaatcacatttaatgtcggatgt
tctaagctgaaatattctacgttatttaaacacgcaaaaaatggcgatattcaagcaatg
tgcgatcaatttccacgctggaaatacgccaacggtaaagtattacgtggacttgaaatc
cgcagacaaaaggaacgtgagctatgtttagccgacttacacaaatcttga

DBGET integrated database retrieval system