KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0254Help
Entry
NT08PM_0254       CDS       T02057                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pul00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NT08PM_0254
Enzymes [BR:pul01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NT08PM_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252508..253122
Genome map
AA seq 204 aa AA seqDB search
MIGHLTGRLVEKHPPEILLDVQGVGYELLLPMTSFYQLPDIGQQTALFTHLVVREDAHLL
FGFSQKTDRTLFRELIKTNGVGPKLALAILSAMSVEEFAYAIEREELSKLVKIPGVGKKT
AERLLVELKGKFKGIQQEDFFIESQHLKQPEHALNEQDIPASEAISALIALGYKAAEAEK
LVKKISKPALSSEQLIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcatttgacgggacgtttagttgaaaaacaccctcctgagattttgttagat
gtgcaaggcgttggctacgaattattattaccgatgaccagcttttatcagcttcccgat
attggtcaacagacagctctatttactcatcttgttgtgcgtgaagatgcacatttactg
tttggtttttcgcaaaaaaccgaccgcactttgtttcgtgaattaatcaaaaccaatggt
gtaggacctaagctcgctctggctattttatcagccatgtcagtggaagagtttgcttat
gcgattgaacgtgaagaactttctaaattagtgaagattcctggggttggtaagaaaaca
gcagaacgtttattagtggaattaaaagggaagttcaaaggcattcaacaagaagacttc
tttattgaaagtcaacatcttaaacagcctgaacatgccttaaatgaacaagatatccct
gccagtgaagctatttctgcgctgattgcgttaggttataaagccgcagaagctgaaaaa
ctggtgaaaaaaatcagcaagccggcactttctagtgagcaacttatccgtgaagcatta
aaagccgccttataa

DBGET integrated database retrieval system