KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0310Help
Entry
NT08PM_0310       CDS       T02057                                 

Definition
cytoChrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Brite
Enzymes [BR:pul01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NT08PM_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302331..303593)
Genome map
AA seq 420 aa AA seqDB search
MANILYDNGCQHCHSTNAELPFYAKFPVAESIMQEDIKKGTRVFLLNEILDGLKDPTKLS
EVSLAKLEQVLINDEMPVAKFVHLHWGSRPDLEEKTTLLNWIREQRQNHFLPANTQGTDP
TRLVQPIPDSVATDPLKVALGDMLYHDGRLSGDGTIQCHTCHQLKNGGVDGLDVSVGIDG
LKGGINAPTVYNSVFNILQFWDGRAKDLAEQAGGPPLNPVEMGSKNWEEIIAKFEQDEAF
KAKFLAVYPAINEATITHAIAEFEKTLITPNSAFDRYLKGEQNALTAAQIRGYELFKQHK
CDTCHVGVAMGGQSFEYMGLFDDYFAARGTPITEADQGRFAHTQDPADMHKFKVPTLRNI
ALTAPYMHDARTSDLKEAVRIMLHYQSGKTLPTKDVEDISAFLESLTGEYQGKLLTKENQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatatcttgtatgacaatggctgtcaacattgtcatagtactaatgcagagttg
cctttctatgctaagtttccagtggcagaaagcattatgcaagaagatattaaaaaaggc
acacgtgtctttttgttaaatgagattcttgatgggttaaaagatcctactaaattgtct
gaagtcagcctcgctaaattagaacaagttctgattaatgatgagatgcctgtcgcaaaa
tttgtacatttacactggggatcacgtcctgatttagaggaaaaaacaacgctattaaat
tggatacgtgagcaacgccagaaccattttctacccgcaaatacacaaggtacagaccca
acgcgtttagtccaaccgattcctgatagtgtagcaacggatccactgaaagtcgcattg
ggtgacatgctataccacgatggacgtctttcaggtgatggtacaatccaatgtcatact
tgccatcagttgaaaaatggtggtgtagatggtctagatgtttctgtcggtattgatggt
ctcaagggaggaattaatgccccaacagtgtataactccgttttcaatattttacaattc
tgggatggacgagcaaaagatctcgctgaacaagccggcggtcctcctctcaacccagtt
gaaatgggctctaagaattgggaagaaattatcgctaaattcgaacaagatgaagcattt
aaagccaagttcttagccgtttatcctgcgattaatgaagccacaattacacacgccatt
gcggaatttgaaaaaacattgatcacaccaaacagcgcatttgaccgttatttgaaaggc
gaacaaaatgcactcacagccgcacaaatacgtggttatgagctcttcaaacagcacaaa
tgcgatacttgccatgttggcgtcgcaatgggtgggcaatcctttgagtacatgggctta
tttgatgattactttgccgccagaggcacaccgataacagaagctgatcaaggacgcttt
gcacatacccaagatcctgctgatatgcataaatttaaggtaccgactctacgtaatatt
gctctgactgcaccatatatgcacgatgctcgcacatcggatctcaaagaagccgtgcgt
attatgttacattatcaaagtggtaaaacgttaccgaccaaagatgtagaagatatcagt
gcattcttagaatcactcaccggtgaatatcaaggcaagttattaaccaaagaaaatcag
taa

DBGET integrated database retrieval system