KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0392Help
Entry
NT08PM_0392       CDS       T02057                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT08PM_0392
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NT08PM_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(393266..393763)
Genome map
AA seq 165 aa AA seqDB search
MKSVYIALGSNLQTPIAQLEAALAALANLPTTQLIHVSSFYQSKPLGPQDQPDYVNAVAH
LRTTLPPLTLLDHLQQIENTQGRVRLRRWGERTLDLDILLYEHVVCQTERLTLPHYDMTN
REFVIVPLFEIAPDLCLPSGQSLLELMKKFEDHQMQKIRTASSLD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgtctatattgcattaggaagcaatttacaaacaccaattgcgcagttagag
gcggctctggcagcattagctaacttacctacaactcagctaatccatgtcagttctttt
taccaaagtaagccacttggtccacaagatcagccagattacgtaaatgcggtagcgcat
ttacgaactacgctaccgcccttaacgctccttgatcatttacagcagattgaaaataca
caaggtagagtgcgccttcgccgttggggtgaacgcactttagatctagatattttgctt
tacgagcatgtcgtatgtcagactgaacgcttgacccttccccactacgatatgaccaat
cgtgaatttgtgatcgttcccctgttcgaaattgcccctgatttatgtttaccgagtgga
caatctctgctggaattaatgaaaaaattcgaagatcaccaaatgcagaaaatacgtaca
gcgtctagtcttgattag

DBGET integrated database retrieval system