KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0439Help
Entry
NT08PM_0439       CDS       T02057                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NT08PM_0439
   00240 Pyrimidine metabolism
    NT08PM_0439
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NT08PM_0439
   03430 Mismatch repair
    NT08PM_0439
   03440 Homologous recombination
    NT08PM_0439
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NT08PM_0439
DNA replication proteins [BR:pul03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NT08PM_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
439544..439972
Genome map
AA seq 142 aa AA seqDB search
MSKHAQFYLLSEQAQMEKMACDFAASAWRLGKRVLIACETEQQALDIDEALWAREADEFV
PHNLSGEVTTYATPIEVSWKGKRNAQRRDLLINLQAEVPDYVSSFTQVIDFVPVEEHLKV
LARERYKQLRQLGWQLSTEQIK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacacgcgcaattttatttgttaagtgagcaagcacaaatggaaaaaatggct
tgtgattttgccgcatccgcgtggcgtcttggtaagcgcgtgttaattgcttgcgaaact
gaacaacaagcgttggatattgatgaagccttatgggcaagagaggcagatgagtttgtg
ccgcataatttatcaggtgaagtgacgacgtatgctacaccgattgaggtgagctggaaa
ggtaagcgtaatgcgcaacgcagagatctcttgattaatttacaggcagaggtaccagat
tatgtcagcagttttacacaggtgattgattttgtgccagtggaagagcatttaaaagtg
ctagccagagagcgttataaacaattacgacaacttggctggcaattatcaacagagcaa
atcaagtaa

DBGET integrated database retrieval system