KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0576Help
Entry
NT08PM_0576       CDS       T02057                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT08PM_0576
Enzymes [BR:pul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NT08PM_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604814..605470
Genome map
AA seq 218 aa AA seqDB search
MNKISPEAEKVRNALLSKGIETPMITPEQDRDTRRARIEQHMREVMKLIGLDLRDDSLEE
TPVRLAKMFVDEIFSGLDYANFPKITNIENRMKVSEMVLVNDVTLTSTCEHHFVTIDGMV
SVAYYPKKWVIGLSKINRIVAFFAQRPQVQERLTEQILLAFQTILETDDVAVYVKATHFC
VKCRGIKDTNSYTVTSAFGGVFLDDRETRKEFLTLINK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatttcaccagaagcagaaaaagtccgcaacgcattattaagtaaggggatt
gaaaccccaatgattaccccagaacaagacagagatacgcgtcgagcgaggattgaacaa
catatgcgtgaagtgatgaagctgattgggttagatttacgtgatgatagtttagaagaa
acccccgtgcgtttggcgaaaatgtttgttgatgaaattttcagcggattagactatgcg
aatttcccgaaaattactaacattgaaaatcgtatgaaagtcagtgaaatggtgttggtg
aatgacgtgacgttaaccagtacttgtgaacaccattttgtgaccattgatgggatggtt
tcggtggcgtattacccgaaaaaatgggtcattgggttgtctaaaattaatcgcatcgtg
gcgttttttgcgcaacgtccacaagtacaagagcgtttgactgaacaaattttgttggca
ttccaaacgattttagaaacggacgatgtggcggtgtatgtgaaggctactcatttctgc
gtgaaatgccgtggcattaaagataccaacagttatacggtgacatccgcatttggtggt
gtctttttagatgaccgtgaaacgcgtaaagagtttttaaccttaattaataaataa

DBGET integrated database retrieval system