KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0722Help
Entry
NT08PM_0722       CDS       T02057                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT08PM_0722
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT08PM_0722
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT08PM_0722
Enzymes [BR:pul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT08PM_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756450..757658
Genome map
AA seq 402 aa AA seqDB search
MSETLLNPYFGEFGGMYVPEILMPVLKNLEKAFVEAQQDPTFKETFLDLLKNYAGRPTAL
TRCRNLTQGSKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLGMPCQIYMGAKDVERQSPNVFRMRLMGANVTAVTKGSASLKDACCEAMRDWAE
NYEHTHYLLGTAAGPHPFPTIVREFQKIIGEETKQQILAREGRLPDAVIAAVGGGSNAIG
IFNDFIEETSVRLIGVEPAGKGIATGQHGAPLGHGTTGIYFGMKAPLMQTPDGQIEESYS
ISAGLDFPSVGPQHAHLQAIGRAQYESITDDEALSAFQALARHEGIIPALESAHALAYAL
KLIQRQPEKEQLLVVNLSGRGDKDIFTVDRILSQKGVSHAPF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaccttacttaatccctatttcggcgaatttggaggaatgtatgttcccgaa
attctgatgccggtgttgaaaaatctcgaaaaagcctttgttgaggcacaacaagatccc
acatttaaagaaaccttcctcgatttattgaagaactatgcaggtcgcccaactgcgctg
actcgctgtcgcaatctcactcaaggcagtaaaaccaaactgtacctgaagcgtgaagat
ttattgcacggcggtgcgcataaaaccaatcaagtattagggcaaatcttattagcgaaa
cggatgggcaaaacccgtattattgcggaaacgggggcgggacaacatggcgtagcaaca
gctctcgcttgtgccatgctcggtatgccatgccaaatctacatgggcgcaaaagatgtt
gaacgtcaatcgccgaatgtatttcgtatgcgtttaatgggggcgaatgtgactgcggta
acaaaaggctcagcctcattaaaagatgcctgctgtgaagccatgcgcgattgggcagaa
aactatgaacacacccattatttactcggcacagcagcaggtcctcatccctttcctact
atcgtgcgtgagttccaaaaaatcattggtgaagaaaccaagcaacaaattctagcacgc
gaagggcgtttacctgatgcagtcatcgccgcggttggtggggggtcaaatgccattggt
atattcaatgactttatcgaggaaaccagcgtacgtttaattggtgttgaaccagcgggc
aaaggaattgccactggacaacatggcgctccactaggtcatggcacaacaggaatctac
tttggtatgaaagcgccattaatgcaaacaccagatggacaaattgaagaatcgtattcg
atttcagcaggacttgattttccttctgttggtccacagcacgcacatttacaagcgatt
gggcgtgcccaatatgaatccattaccgatgatgaagccttatccgccttccaagcctta
gcacgccatgaaggcattattcccgcattagaaagtgctcatgccctcgcttatgcctta
aaactgattcagcgccagcctgaaaaagaacaactcttggtggtcaatttatctggacga
ggtgataaagatatttttaccgtagatcgcattttatcgcaaaaaggagtttcacatgcg
ccgttttga

DBGET integrated database retrieval system