KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0723Help
Entry
NT08PM_0723       CDS       T02057                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT08PM_0723
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT08PM_0723
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT08PM_0723
Enzymes [BR:pul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT08PM_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757645..758451
Genome map
AA seq 268 aa AA seqDB search
MRRFDTLFSQLQQKQQGAFVPFVTLCDPNLAQSFEIIQTLVENGADALELGFPFSDPMLD
GPVIQAANQRALAAGCSTDASFQLLTQVRSTYPTLPISLLLCANLVYAQGIERFYQRCAE
VGVDAVLIADLPLFAHREFTVMAEKYSIQQVFICPPNACENTIKRVAQQTQGYTYLVSRS
GVTGVENQQSAGNLKTLVERLKAYQAPPILQGFGISQPQQVSDVLKMGVNGAISGSATVQ
IIEKYRHDPQACLAELAQFTQKMKQATA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttttgataccctcttttcacaattacaacaaaaacaacaaggtgcatttgtc
ccttttgtcacgctatgcgatcctaatctggcacagtcatttgagattattcaaacctta
gtggaaaatggtgcagacgccttagaattaggctttcctttttctgatccgatgttagat
ggtccagtgattcaagccgctaaccaacgtgcgttagccgcaggttgtagcacagatgct
agttttcagttattaacacaagtacgatcaacttatccgacactaccaataagtttactg
ctttgtgccaatctggtttatgcacaaggcattgaacgtttttatcaacgttgtgctgaa
gtgggcgtggatgcggtattaattgcggatttaccattattcgcccatcgagagtttacg
gttatggctgaaaaatatagcattcagcaggtttttatctgtccgcctaatgcctgtgaa
aacacgatcaaacgtgtcgctcaacaaacacaaggttacacctatttagtttctcgttca
ggtgtaacaggagtagaaaatcaacaatctgctggcaacttaaaaacactcgtcgagcgc
ctcaaagcctatcaagctccccctattttgcaaggctttggtatttcgcaaccacagcaa
gttagcgatgtgttaaaaatgggcgtcaatggtgccatttcgggttccgctaccgttcaa
attattgaaaaatatcgccatgacccacaagcctgcttagctgaactagcgcagtttacg
caaaaaatgaaacaagcgaccgcataa

DBGET integrated database retrieval system