KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0759Help
Entry
NT08PM_0759       CDS       T02057                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pul00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(802959..805151)
Genome map
AA seq 730 aa AA seqDB search
MVQLVSPSVINQFFEGTHADPFSVLGMHETEKGIEIRALLPDASRVVVIDRETHNAVCEL
EHVDERGFFAAVIPKTRTFFAYQLQVFWGAESQFIEDPYRFHPMLEDLDNWLLSEGSHLR
PYEVLGAHFMECDGVSGVNFRLWAPNAKRVSIVGDFNYWDGRRHPMRFHQKSGVWELFLP
KASLGQLYKFELIDCHGQLRLKADPYAFSSQLRPDTASQISALPEIVPMTEQRRKANQFD
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVKEMGFTHIEFLPISEFPFDGSWGY
QPLGLYSPTSRFGTAEGFKRLIEKAHQAGINVILDWVPGHFPSDTHGLAAFDGTALYEHA
DPREGYHQDWNTLIYNYGRNEVRNFLSSNALYWLERFGLDGIRVDAVASMIYRDYSRAEG
EWIPNQYGGRENLEAIEFLKHTNWKIDSEVQGAISIAEESTSFAGVTKPSTEGGLGFHFK
WNMGWMNDTLSYMQKDPVYRQYHHDQMTFGMVYQYSENFVLPLSHDEVVHGKCSLLGKMP
GDAWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYQESLDWFLLEEEHGGRWHQG
VQLLVKDLNHIYQQHASLFELDGSPEGFDWLVVDDRQNSVFAFERRSKDGERIIVVSNFT
PVPRHDYRFGVNMAGNYVEILNTDSAFYQGSNVGNYGEVGSEAIPSHARAQSICVSIPPL
ATIYLKYQGE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattagtttcaccttccgtgatcaatcaattttttgaaggaacgcatgcagac
ccattttctgtgttagggatgcatgaaacagagaaaggaattgaaattcgcgcattattg
ccggatgcgagccgtgtggttgtgattgacagggaaacacacaacgccgtttgcgagtta
gagcacgtcgatgaacgcggtttctttgccgcggtcataccgaaaacaagaacgtttttt
gcctatcagttacaggttttttggggcgctgaatcacaatttattgaagatccttaccgt
ttccatccgatgctggaggatttagacaattggctgttgagtgaaggatcgcatttacgt
ccttatgaagtgcttggtgcgcattttatggaatgtgatggcgtgtctggggtgaatttc
cgtttatgggcaccaaatgcaaaacgtgtttcgattgtgggcgattttaactattgggat
gggcgtcgccacccaatgcgttttcatcaaaagagcggtgtgtgggaactgtttttaccg
aaagcctcattgggtcaactgtataaatttgaattgatagactgtcatggtcagttacgc
ttaaaagcggatccttatgcctttagttcacaactgcgtcctgatacggcctcacaaatt
agcgcgttacccgaaattgtgccaatgacagaacaacgtcgtaaagcgaatcaatttgat
caacccatttcgatttatgaagtccatcttggttcgtggcgtcgcaatttagaaaataat
ttttggttggattatgatcaaatcgccgatgagctcattccttatgtgaaagagatgggc
tttactcacattgaatttttaccgatttctgaatttccatttgatggttcttggggctat
caacccttggggctgtactcgccaaccagtcggtttggtacggcagaaggctttaagcgt
ttaattgaaaaagcacaccaagctgggatcaatgttattttagactgggtacccggtcat
ttcccaagtgatactcacggcttagcggcatttgatggcactgcgctttatgaacatgct
gatccgcgtgaaggctaccaccaagattggaataccttaatttataactatggacgtaat
gaagtgcgtaactttttatccagcaatgcactttattggctagaacgttttggtttagat
ggtattcgggtggatgccgttgcttcgatgatttatcgtgattatagccgtgccgaagga
gagtggattccaaaccaatacggtggacgtgaaaatttagaagccattgaatttttaaaa
cacactaactggaaaattgattctgaagtacaaggcgcgatttcgattgctgaagaatcg
acatcttttgcaggcgttaccaagccgtccacagaaggggggctaggattccactttaaa
tggaatatgggctggatgaatgacaccttgtcttacatgcaaaaagatccagtgtatcgt
caatatcaccacgatcaaatgacttttggtatggtgtatcaatacagcgaaaattttgtg
ttaccgctatcccacgatgaagtggtacacggtaaatgttctttactcggtaaaatgccg
ggcgatgcgtggcaaaaatttgctaacttgcgcgcttattatggttatatgtggggctat
ccgggtaaaaaattgctctttatgggcaatgaatttgcgcaagggcgcgaatggaattat
caagaaagcctcgattggtttttactggaagaagagcacggtgggcgatggcatcaaggc
gtgcaattgttagtgaaagatctcaatcatatttatcaacaacatgcctcgttatttgaa
ctcgacggctcgccagaaggatttgactggttagtggttgatgatcgtcaaaactcggtg
tttgcctttgaacgccgcagtaaagacggagagcgaattattgtcgtgagtaacttcacg
ccagtaccacgtcatgattatcgttttggcgtcaatatggcgggtaactatgtggaaatc
ttaaacacagattcggcattttatcaggggtcgaatgttggtaattacggtgaagtaggc
agtgaagcgattccaagccatgcgcgagcacaatcaatttgtgtatctattccgccactc
gccacgatttatttgaaatatcaaggggaataa

DBGET integrated database retrieval system