KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0760Help
Entry
NT08PM_0760       CDS       T02057                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT08PM_0760
Enzymes [BR:pul01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NT08PM_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(805183..807276)
Genome map
AA seq 697 aa AA seqDB search
MDIAYIRREAEKQGIAPSHYDINGNLIYASQETLTYFTDLLKSSSATSEAQLHFDDVVVF
LENEPIQYALTRLPVVNQTPLSCQIMDEAGKHILTQSCIERDIITLPALEFGYYHLRITY
ENHAYSVRLLISPKTAYQPPVLQQRKAWGLNVQLYSLRSKQNWGIGDFADLAYLVEQATK
YGVDFIGINPLHLMYSAVPEWASPYSSSSRRWLNPIYLSVTTLPEFKCCKSVQHWFASDE
IQDLLEQLQATELVDYAQVMWLKQRALEQLFAFSKRSQSTSIIQRRQAFLQFMQQQGEPL
LLQGLFEVLDRQSHSNMPTEKEIGWLGWRREWQQLSPAKRQTLLKTHQAEIEFYAWLQWL
ATEQLTDIQALCHRLGMNLGIYGDLAVNSSRGSADVWIDPELYFVNASVGAPPDPLGPVG
QNWNLPPYNPAILTRRGFQPFIDMLRSNMQHFGILRIDHVMGLFRLWLIPEEKSAADGVY
VHYPFDALMAILTIESQRNRCLIVGEDLGTVPDEVRSKLNQLHIFSYFVLYFEQRNRQYP
ASEQFPVKAFATIGTHDVPSLQSFWHCVDLQLFNQLGILDGEILQQKYEQRVIDKQALLD
TLHRDGYLPPHYEGNALSMAMHAHLNYVLHQYLARSCTQLIGVQLENVLSQEISFNLPGT
DREYPNWRKKLACTLEQMFSDKHITAFLGAIDQARHA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcatacatccggcgggaggctgaaaagcaaggcattgcgccctctcattat
gacattaatgggaatttgatttacgccagccaagagacgttaacttattttacggattta
ttgaaatcttcgtcagccacatcagaggcacaattacattttgatgatgttgtcgtgttt
cttgaaaatgaaccgattcagtatgcattaacgcgtcttcctgtggttaaccaaacgcca
ctgtcttgccaaatcatggatgaagcgggtaaacatattctgacacaatcctgtattgag
cgtgacattatcaccttacctgcacttgagtttggttattatcatctgcggatcacttat
gaaaatcacgcttattctgtccgtttattgatcagtcctaaaacagcgtatcaaccccct
gtgttacagcaaagaaaagcatggggattgaacgttcaattatatagcttacgctcgaag
cagaattggggaattggggattttgcagacctagcgtatttagtcgaacaggcgacgaag
tatggtgtggattttattggtattaatccgttgcatttgatgtatagtgcggtaccagaa
tgggcgagcccttatagctcatcttctcgtcgttggttgaaccctatttatttatctgtg
accacattgccagaatttaaatgctgtaaaagcgtgcagcattggtttgcctccgacgag
attcaagacttgcttgagcagttacaagcaacagaattagtggattatgcacaagttatg
tggttaaagcagcgtgcacttgaacaattgtttgctttctcaaagcgcagtcaatcgact
tctatcattcaacgccgtcaagcctttttgcaattcatgcaacagcaaggtgaaccgtta
ttgttacaaggcttatttgaagtattagaccgtcaatcgcactcaaatatgccaacagaa
aaagagattggctggctaggttggcgtcgtgaatggcaacagttaagcccagcaaaacgc
caaacgttactcaaaacgcatcaagcagagattgagttttacgcttggttacaatggtta
gcgacagaacaattaacggatattcaagcattgtgtcatcgcctcggcatgaatttgggg
atttatggtgatttggcagttaatagttcacgcggtagtgcggatgtgtggattgatccc
gaattgtactttgtgaatgcctccgtaggggcgccgccggatcctttaggacccgttggg
caaaactggaacttacccccttataatcctgcgatcttaacccgccgtggttttcaacct
tttattgatatgttgcgcagtaatatgcagcattttgggatcttgcgtattgaccatgtg
atggggttattccgtttatggttgattcccgaagaaaaaagcgcagccgatggtgtgtat
gtccattatccctttgatgcgttaatggcgattttaacgatagaaagccaacgcaatcgt
tgcttgattgtaggggaagacttgggcactgtcccagatgaagtgcggtcaaaattaaat
cagttacacattttttcttactttgtcttatattttgagcaacgtaatcgtcaatatccc
gcaagtgagcaatttccagtgaaagcttttgctaccattggcacgcatgacgtaccgtcg
ttacaaagtttctggcactgtgttgatttacaactttttaatcaactcggcattctagac
ggtgagatcttgcaacaaaaatatgaacaacgcgtgattgataaacaagcattattggac
acgttgcatcgtgatggctatttgccccctcattatgaaggaaatgccttatcaatggcg
atgcatgctcatcttaactatgtgttacaccaatatttagccagaagttgtactcaattg
attggggtacaactggaaaatgtattaagccaagaaatttcatttaatttacccggtact
gatagggaatatccaaactggcgtaaaaagctcgcatgtacacttgaacaaatgtttagt
gataagcatatcaccgcgtttttaggcgcgattgatcaagctcgtcatgcatga

DBGET integrated database retrieval system