KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0789Help
Entry
NT08PM_0789       CDS       T02057                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pul00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NT08PM_0789
Enzymes [BR:pul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NT08PM_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(832502..833968)
Genome map
AA seq 488 aa AA seqDB search
MLATLKELKQHKVISEGDYYFAQLIADKQPDELSREQKNLAILLAALCSYSYQQGNTCLF
LEKGLESNYFNLAYRTAEQHYLHIIQEKIAFLPIECWQSSLADHIAFTATPLEKVAPLVF
QFNALYFYRIWQDEYRVAHYLQRAVQRGAETAPIAYEQIQAILMHYFPAVQQIEGVNWQK
VAVATALKQPFCLITGGPGTGKTTTVARLLLALQTLSACQLKIKLVAPTGKAAARLTESI
NGALTRLAQENMAISADLIASIPTTAQTLHRLLGIRFFEETPTFHPNNPLPLDVLVVDEA
SMIDLPLMAKLLQALKPNTKLILLGDENQLSPVEAGEMLGALSEFSQHAYSPTLTQYLKA
VADIELISSDQGSPLRDHLCRLHHSHRFSGDSGIGQLAQAINQGNVEVSWNAFTHFNDIE
MVDFDQVALLKGDNPSLYSQACAALVVKSAVEKYTDYLVKLKALQQQSPILNEQQVGEIL
SCLMRFVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctaccttaaaagaattaaaacaacacaaagtgatcagtgaaggagattattac
tttgcacaattgatcgcggataagcaaccagatgaactgtcgcgggaacagaaaaattta
gccatattgcttgccgcactttgtagttacagctatcaacaaggcaatacttgcttgttt
ctagagaaagggctggaatctaattattttaatttggcttatcgaacagcagagcagcat
tatctccatattattcaagaaaaaattgcttttctaccgattgaatgttggcaatcaagc
ttggcggatcatatagcgtttacagcaacgccactggaaaaagtcgcccctttagtgttt
cagtttaatgcgctttatttttatcgtatctggcaagatgaataccgagttgctcattat
cttcaacgtgcagtacagcggggggctgagacagcgcctattgcttatgagcaaatccaa
gcgatcttaatgcactattttcctgcggtacagcaaattgaaggggtgaattggcaaaaa
gtagcagtagcgaccgcgttaaaacaaccattttgtttgattacaggtggtccaggaaca
gggaaaaccactactgtcgcacgtttactcttggcgttacagacactgtctgcgtgtcag
cttaagattaagttagttgcacctacaggcaaagcggcagcacgcttgacggagtcaatt
aatggtgcgttaacgcgtttagcacaagaaaatatggcgatcagtgccgatttaattgcc
tctattccgactacagcgcagaccttacatcgtttattgggcatacgtttttttgaagaa
acacccacttttcatccaaacaatccattgccattggatgtattggtggtcgatgaggcg
tctatgattgacttgccattaatggcgaaattattacaggcactcaaaccgaataccaaa
ttaattttgcttggagatgaaaatcaattgtctcctgtggaagcaggggaaatgttggga
gcgttgtctgaattttctcaacacgcctatagtcctacgttaacccagtatttaaaagca
gtggcggatattgagttaatttcgtcagatcaaggttccccgttgcgtgatcatttatgc
cgtttgcatcatagtcatcgtttttcgggggattctgggattgggcaattagcgcaggcg
attaatcaaggcaatgttgaggtaagttggaacgcatttacccattttaatgatatcgaa
atggtggattttgatcaggttgccttattaaaaggagataacccgagtttatatagccaa
gcgtgtgcagcgttagtggtaaaaagtgcggttgaaaaatacacagattatttagtgaaa
ctgaaagcattacaacaacagtcgcctatactgaatgaacaacaagtgggagaaattttg
tcttgtttaatgcggttcgtttcttaa

DBGET integrated database retrieval system