KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1045Help
Entry
NT08PM_1045       CDS       T02057                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
pul00020  Citrate cycle (TCA cycle)
pul00640  Propanoate metabolism
pul00660  C5-Branched dibasic acid metabolism
pul01100  Metabolic pathways
pul01110  Biosynthesis of secondary metabolites
pul01120  Microbial metabolism in diverse environments
pul01130  Biosynthesis of antibiotics
pul01200  Carbon metabolism
Module
pul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pul_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT08PM_1045
   00640 Propanoate metabolism
    NT08PM_1045
   00660 C5-Branched dibasic acid metabolism
    NT08PM_1045
Enzymes [BR:pul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NT08PM_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFI46166
Position
complement(1110838..1112004)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQIFAEYQLPVGKGYACKSADEAADAIKKLNGDVWVAKCQVHAGGRGKAGGV
KLVRNEAEVRAFADQWLGQRLVTFQTDANGQPVNTLYVEEGSSIAHELYLGAVLDRASQR
VVFMVSTEGGVNIEEVAEKTPHLLHKMAIDPLTGGMPYQGRELAFKLGLKGDQIKQFAHI
FVQMAKMFVEKDLALLEVNPLVVTKEGNLLCLDAKIVVDSNALYRQPALKAMQDPSQEDP
REALAESHQLNYVALEGNIGCMVNGAGLAMGTMDIIKLHGGQPANFLDVGGGATKERVAE
AFKIILSDSAVKAVLVNIFGGIVRCDLIAEGIIAAVNEVGVNVPVVVRLEGNNAPLGREI
LANSGVNIIAANTLTDAAIQAVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacacgagtatcaagcgaagcaaatttttgcagaatatcaattgccagtaggc
aagggttatgcgtgtaaaagcgcagatgaagccgcagatgcaataaaaaaactcaatggt
gatgtttgggtcgcaaaatgccaagttcacgcaggtgggcggggtaaagccggtggtgtg
aaattggtgcgtaacgaagccgaagtgcgtgcttttgctgaccaatggttaggacaacgc
ttagtgactttccaaacggatgctaatgggcaacctgttaatactctttatgtggaagaa
ggatcgagcattgcacatgagttgtatttaggcgcagtgcttgatcgtgcatcacaacgt
gttgtgtttatggtatccactgaaggtggggtaaatatcgaagaagtggcggaaaaaaca
ccgcacttattacataaaatggcgatagatcctctaacgggggggatgccataccaaggg
cgtgaacttgcgtttaaactgggtttaaaaggtgatcaaattaaacaatttgctcatatt
ttcgtacaaatggcaaaaatgtttgtggaaaaagacttggcgctgttagaagtgaatccg
ttagtggtgaccaaagaaggtaatttactgtgtttagatgccaaaatcgtggtcgatagt
aacgccttataccgtcagccagcattaaaagcgatgcaagacccaagccaagaagatcca
cgtgaagcgcttgcagaatcacaccaattaaactatgtggcacttgagggtaacattggt
tgtatggtgaatggtgcaggcttagccatggggaccatggatattattaaattacacggg
ggtcaaccggcaaacttccttgatgtgggcggtggggcgaccaaagagcgtgtggcggaa
gcattcaaaattatcttatcggatagtgcagtaaaagcggtattagtgaatatctttggt
ggtatcgtgcgttgcgatttaattgcagaagggatcattgctgccgtgaatgaagtaggc
gtcaatgtgcctgtggtggtccgtttagaagggaataatgcgcctttaggtcgtgagatt
ttagcaaacagtggtgtgaatattattgcggcaaatactttaacggatgctgcgattcaa
gctgtgaaagccgcggagggaaaataa

DBGET integrated database retrieval system