KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1045Help
Entry
NT08PM_1045       CDS       T02057                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT08PM_1045
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT08PM_1045
   00640 Propanoate metabolism
    NT08PM_1045
   00660 C5-Branched dibasic acid metabolism
    NT08PM_1045
Enzymes [BR:pul01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NT08PM_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1110838..1112004)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQIFAEYQLPVGKGYACKSADEAADAIKKLNGDVWVAKCQVHAGGRGKAGGV
KLVRNEAEVRAFADQWLGQRLVTFQTDANGQPVNTLYVEEGSSIAHELYLGAVLDRASQR
VVFMVSTEGGVNIEEVAEKTPHLLHKMAIDPLTGGMPYQGRELAFKLGLKGDQIKQFAHI
FVQMAKMFVEKDLALLEVNPLVVTKEGNLLCLDAKIVVDSNALYRQPALKAMQDPSQEDP
REALAESHQLNYVALEGNIGCMVNGAGLAMGTMDIIKLHGGQPANFLDVGGGATKERVAE
AFKIILSDSAVKAVLVNIFGGIVRCDLIAEGIIAAVNEVGVNVPVVVRLEGNNAPLGREI
LANSGVNIIAANTLTDAAIQAVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacacgagtatcaagcgaagcaaatttttgcagaatatcaattgccagtaggc
aagggttatgcgtgtaaaagcgcagatgaagccgcagatgcaataaaaaaactcaatggt
gatgtttgggtcgcaaaatgccaagttcacgcaggtgggcggggtaaagccggtggtgtg
aaattggtgcgtaacgaagccgaagtgcgtgcttttgctgaccaatggttaggacaacgc
ttagtgactttccaaacggatgctaatgggcaacctgttaatactctttatgtggaagaa
ggatcgagcattgcacatgagttgtatttaggcgcagtgcttgatcgtgcatcacaacgt
gttgtgtttatggtatccactgaaggtggggtaaatatcgaagaagtggcggaaaaaaca
ccgcacttattacataaaatggcgatagatcctctaacgggggggatgccataccaaggg
cgtgaacttgcgtttaaactgggtttaaaaggtgatcaaattaaacaatttgctcatatt
ttcgtacaaatggcaaaaatgtttgtggaaaaagacttggcgctgttagaagtgaatccg
ttagtggtgaccaaagaaggtaatttactgtgtttagatgccaaaatcgtggtcgatagt
aacgccttataccgtcagccagcattaaaagcgatgcaagacccaagccaagaagatcca
cgtgaagcgcttgcagaatcacaccaattaaactatgtggcacttgagggtaacattggt
tgtatggtgaatggtgcaggcttagccatggggaccatggatattattaaattacacggg
ggtcaaccggcaaacttccttgatgtgggcggtggggcgaccaaagagcgtgtggcggaa
gcattcaaaattatcttatcggatagtgcagtaaaagcggtattagtgaatatctttggt
ggtatcgtgcgttgcgatttaattgcagaagggatcattgctgccgtgaatgaagtaggc
gtcaatgtgcctgtggtggtccgtttagaagggaataatgcgcctttaggtcgtgagatt
ttagcaaacagtggtgtgaatattattgcggcaaatactttaacggatgctgcgattcaa
gctgtgaaagccgcggagggaaaataa

DBGET integrated database retrieval system