KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1047Help
Entry
NT08PM_1047       CDS       T02057                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT08PM_1047
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT08PM_1047
  Amino acid metabolism
   00310 Lysine degradation
    NT08PM_1047
Enzymes [BR:pul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NT08PM_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112583..1113797)
Genome map
AA seq 404 aa AA seqDB search
MSNFEIITPDLPESVADATVVTWHKKVGDVVKRDEILVEIETDKVVLEVPAQSDGVLEAI
IEAEGATVISKQLLGKLSATAVAGGVTKETVVTQEPTPADRHHANLSTESVGSDSVSPGV
RRLIAEHDLNAENIKGSGVGGRITREDVEKVIAQKANKAPNKPAEPAFVVGNREEKRVPM
TRLRKRIAERLLEAKNSTAMLTTFNEVDMAPIMKLRKTYGEKFEKQHGTRLGFMSFYIKA
VVEALKRYPEVNASIDGDDIIYHNYFDISIAVSTPRGLVTPVLRNCDKLSMADIEKEIKA
LADKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAVNGE
VVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattttgagattataactcccgatttaccagaatctgtcgccgatgcaacggtt
gtaacttggcataagaaagtgggtgatgtcgtaaaacgtgatgagattttagtcgaaatt
gaaaccgataaagtggtacttgaagtcccagcacaatctgatggtgtacttgaagcgatt
attgaagcagaaggcgccaccgttatcagtaaacaattattaggtaaattgtcagccaca
gccgtagcgggtggtgtcactaaagaaacggttgtcactcaggagccaacgccggcggat
cgccatcatgcgaatttaagtactgaatcagtgggtagcgactcggtgagcccgggggta
cgtcgtttaattgctgagcatgacttaaatgcagaaaacattaaaggaagcggtgtgggc
gggcgtattacacgcgaagatgtggagaaagttatcgcgcaaaaagccaataaagcgccg
aataagccggctgagcctgcgtttgttgtcggtaatcgtgaggaaaaacgtgtaccaatg
acacgtttacgcaaacgtattgcggagcgtttgttagaagcgaaaaacagcacggcaatg
ttaaccacatttaacgaagtggacatggcgccgattatgaaattacgtaaaacttatggt
gagaagtttgaaaaacaacacggcacgcgtctcggttttatgtcgttctacattaaagct
gtggtggaagcactaaaacgttatccagaagtcaatgcgtcgattgatggtgacgatatc
atttatcataactatttcgatatcagcatcgcggtttcgacaccacgtggtttagttacc
ccagtattacgcaactgcgataaattaagcatggcggatattgaaaaagaaattaaagcg
cttgctgataaggggcgtgacggaaaattaacagttgaagatttaaccgggggtaacttt
actattactaatggtggtgtgttcggttccctcatgtctaccccgattatcaatcctcca
caaagtgccattttaggcatgcatgccattaaagatcgccccgtggcggtgaatggcgaa
gtggtgattcgtccgatgatgtatcttgcgctctcctatgatcaccgtttaattgatggt
cgtgaatcagttggtttcttagtaacgattaaagaattgttggaagatccaacccgttta
ttgttagaaatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system