KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1081Help
Entry
NT08PM_1081       CDS       T02057                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NT08PM_1081
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NT08PM_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153877..1154764
Genome map
AA seq 295 aa AA seqDB search
MQHYHFSHSLLAQQEKPYRFPCPAKLNLFLYINGKRQDGYHELQTLFQFVDFGDWLDIEV
REDNEICLTPELPSLKNEDNLVYRAAKLLQQKTNCALGANLTLDKILPMGSGLGGGSSNA
ATALVALNYLWNTQLSTKQLAKLGLMLGADVPIFVHGHAAFAEGVGEKITYCEPKEKWYV
VLKPNVSISTATVFSDPDLIRNTPKQSLEQLLNQKYANDCEKVVLNHYPEVEEILHRLLQ
YAPSRLTGTGACVFAEFNDEESAQLAFQTIPKNYFGFVAQGLNKSPLHNMLAKIS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaacattatcatttttctcactcacttttagcacaacaagaaaaaccatatcgtttc
ccttgtccggctaaacttaacttatttctctacattaatgggaaacgtcaagatggttat
cacgaactacaaaccctttttcaatttgttgattttggtgattggttagatattgaggtt
cgcgaagataacgaaatctgcctaacgccagaacttccctcactaaaaaatgaagataat
ttagtctatcgcgcagcaaaattactgcaacagaaaaccaattgtgctttaggcgccaat
ctgacacttgataagattctaccgatgggaagtgggctcgggggaggctcgtctaatgcg
gcaacagcattagtcgcattaaattacctgtggaatacgcaactcagcacaaaacaactt
gctaaactaggattaatgctcggtgcagacgtaccaatttttgtccatggtcacgcggca
tttgccgaaggtgtaggtgaaaaaattacttattgtgagccaaaagagaaatggtatgtg
gttttaaagccaaatgtgtctatatcaaccgcgaccgtcttttctgatccagatttaatt
cgtaatacccctaagcaatctctggagcaactcctcaatcaaaaatatgcaaacgattgt
gaaaaagttgtgttaaatcattatccagaggttgaagaaatactccacagattgttacaa
tatgcgccatcaagattaacaggcaccggcgcttgtgtatttgccgaatttaatgacgaa
gaaagtgcacaactcgcatttcaaacaatacccaaaaactattttggttttgtcgcacaa
ggattaaataaatcacctttacataatatgctagcgaaaatcagctag

DBGET integrated database retrieval system