KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1125Help
Entry
NT08PM_1125       CDS       T02057                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pul00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NT08PM_1125
DNA repair and recombination proteins [BR:pul03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NT08PM_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1199058..1199660)
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLEHLIESLRCLPGVGPKSAQRMAYHLLQRNRNGGMELARALTEAMSKIGHCSHC
RTFTEEEVCTICNNPRRQHSGLLCVVEQPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLHLLQKRLQEESFHEVILATNPTVEGDATANYIAELCMQQNIKVTRIAHGIPVGGE
LEMVDGTTLTHSFLGRRQLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccattactcgaacatttgatcgaaagtttacgttgtttacccggtgtt
ggaccaaaatctgctcaacgtatggcatatcacttattacaacgtaatcgtaatggcggc
atggaacttgctcgcgctttaacggaagcgatgtcaaaaatcggacattgcagccattgt
cgtacttttacggaagaagaggtgtgcacgatttgtaacaaccctcgccgtcagcattca
ggactactttgtgtggttgagcagccgtctgatattcaagctattgaacaaacaggacaa
ttttcagggcgttattttgtgttaatggggcatttatcgccattagatggaattggtcct
aaagaaattggtttgcatttattacaaaaacgcttgcaagaagaaagctttcatgaagtg
attttggctactaacccaaccgtcgaaggtgatgccacagcaaattacatcgcagagctt
tgtatgcaacaaaatatcaaagtcacccgtattgcgcatgggattccagtggggggggaa
ttagaaatggtggatggtacaaccttgactcattcctttttaggacgtcgccaactcggg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system