KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1141Help
Entry
NT08PM_1141       CDS       T02057                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1216181..1216864)
Genome map
AA seq 227 aa AA seqDB search
MKKILSTLLMLGMSSLTFANSQQVVEQLQKMGLSGVEVSDSPVKGIKTAVTDNGIFYITE
DAKYILDGKLYALSEKGLRDVSSSLLLDKLTAYKNEMVVYPAKDEKHVITVFMDTSCHYC
KVLHKQIKEYNDLGITVRYLAFPRGGVQSKTAREMEAIFTAQDPQFALTEAINGNPPKTL
KDANITKKHYQLGLQFGVNGTPSIVTEKGELIGGYLKPADLLSELAQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcttgagcacacttttgatgttggggatgtcgagtttgacgtttgccaat
tcacaacaagtggtagaacagttgcaaaaaatgggcttatctggtgtagaagtgagcgat
tcgcctgtgaaaggcatcaaaaccgcagtgacggacaatggtattttttacatcacagag
gacgcgaaatatattcttgatggtaagttatatgcactgtcagagaaaggattacgcgat
gtgtcatcaagcttattactagataaattaacagcttataaaaatgaaatggtcgtttat
cccgcaaaagacgaaaaacatgtgattaccgtgttcatggatacttcgtgccattactgc
aaagtgttacataaacaaattaaagaatataatgatctcggcattacagtacgttacctt
gctttcccgcgtggtggcgtgcaatcgaaaacagcacgtgaaatggaagcgatctttact
gcacaagatcctcagtttgcattaactgaagcgattaatggtaatccaccaaaaacgttg
aaagacgctaatatcaccaaaaaacattaccagttaggcttacaatttggtgtgaatggt
accccaagtattgtgaccgagaaaggcgaattgattggagggtatttaaaacccgctgat
ttattgtcggagttagcccagtaa

DBGET integrated database retrieval system