KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1182Help
Entry
NT08PM_1182       CDS       T02057                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NT08PM_1182
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NT08PM_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1250308..1251228
Genome map
AA seq 306 aa AA seqDB search
MKKLTVLGSVNADHVISVPHFAKPGETLTGNHYHIAYGGKGANQAVAAARLGANIDFIAC
IGDDAIGQAMKKAFQQDGINTQAVVEIADQMTGIAMIQVNAHGENSIVIAAGANAYLTET
VVEQFADKITQADTLLMQLETPLSAVIFAAKLAKSANTKVVLNPAPAQPLPDELLTQLDM
ITPNETETEILTGVKVVDEHSAAQAAALFHQKGIETVLITLGSKGVYASQKGTLGKMVAG
FRVDAKDTTAAGDTFNGALMTALLEDKPLADAIRFAHAAAAISVTRAGAQPSIPTRQETL
NFLQSH
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaacggtacttggcagtgtaaatgccgatcatgtcatttctgtcccacac
tttgctaaacccggtgaaaccctcacaggcaatcattaccatattgcgtatggaggaaaa
ggtgcaaaccaagctgttgcggctgctcgcttaggtgccaatattgattttattgcttgt
attggtgatgatgcgattggacaagcaatgaaaaaggctttccaacaagatggcattaat
acacaagccgttgtagaaattgccgatcaaatgacaggaatcgccatgattcaagtcaac
gcacacggggaaaacagtattgtcattgccgccggagcaaatgcttatttaacggaaact
gtcgttgaacaatttgcggataaaattacgcaagcggatactttattaatgcaacttgaa
acccctttaagtgcggtcattttcgcggcaaaattggctaaatcagccaatactaaagtg
gtgttaaatccggcaccggcccagccacttcccgatgagttactcacgcaattggacatg
attacccctaatgaaacagagactgaaatcttgactggggtgaaggtcgttgacgaacat
tctgctgcgcaagcggcggctctctttcatcaaaaaggcattgaaacggtgctcatcact
ttaggctcaaaaggggtttatgcaagtcagaaaggtacgctgggcaaaatggtcgcaggc
tttcgtgtcgatgcgaaagacacaactgccgcaggtgatacgtttaatggcgctttaatg
actgcattgttagaagataaaccgcttgctgatgccatccgttttgctcatgctgccgca
gcaattagcgtcaccagagcgggcgcacaaccctcaattccgactagacaagaaaccctc
aactttttacaatcacattaa

DBGET integrated database retrieval system