KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1198Help
Entry
NT08PM_1198       CDS       T02057                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pul00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pul00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1267808..1269292)
Genome map
AA seq 494 aa AA seqDB search
MRRLTALLGQVELAPNIELTEMILDSRAVKQGCLFVALQGHQVDGRQYIPQAIAKGANAV
LAETEDAQQHLSTKIEQGVPIISFYQLGSHLSALAGLFYDNPSHKLTLVGVTGTNGKTTI
SQLLAQWTTLLGHRSAVMGTIGNGLLGQVKEATNTTGSAVEVQASLADFVTRGADFAAIE
VSSHGLVQHRVEALAFDVAIFTNLSRDHLDYHQSMENYALAKKRLFTELNSRHQIINADD
SVGQTWLQEQPNAVAVSCQTDFKPHQARWLKATAIQFSQKGARIQFESSWGKGELHSALI
GQFNVNNLLLVFATLLSLGYDIEKLMKAVPQLTGVCGRMERLSASNQPTAIVDYAHTPDA
LEKALQAARLHCQGKLWCVFGCGGDRDRGKRPLMAKIAEQFADHVIVTDDNPRTESAAQI
VQDILAGFEHPQHVEVCHARDQAIIQALQKADSDDVVLIAGKGHEDYQIIGTQKQHFSDQ
ETVQQYFKVNHHHA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagattaaccgcacttttggggcaagttgaacttgccccaaatattgaattgacg
gaaatgattctagacagtcgggctgtaaagcaaggctgtctttttgttgcattacagggg
caccaagttgatggacgtcagtatattccgcaagccatcgccaagggggcaaatgcggtg
ttggctgaaacagaggatgcacagcagcatttgagtacgaaaatagaacaaggggtgccg
atcatttcgttttatcaattaggctctcacctttctgcgttagcggggcttttttatgat
aatccgtcgcacaaattgaccttggttggggtcactggcacgaatggcaaaactactatt
tcgcaattgttagcgcaatggacaacattactggggcatcgcagtgctgtgatgggaacg
attggcaatgggttgttggggcaggtaaaagaagcaaccaataccactggatctgcggtg
gaagttcaagcttctttagcggattttgttacgcgaggtgcagatttcgccgcgattgag
gtttcatcacatggactagtgcagcaccgcgttgaagcgttagcctttgatgttgctatt
tttaccaatctcagccgtgatcatttggattatcatcaaagtatggaaaattatgcgttg
gccaaaaaacgcttatttaccgaattgaattcccgacaccaaattattaatgcagacgat
agcgtcggacaaacttggttacaggaacaacccaatgcagtagccgtcagctgtcagaca
gattttaaacctcatcaagctcgttggttgaaagcaactgcgattcagtttagtcagaaa
ggtgcacgaattcaatttgaatcaagttggggaaaaggcgaattacatagtgcgttgata
gggcagtttaatgttaataatttgctgttggtgtttgctaccttactttcattgggctat
gacatcgaaaaactcatgaaggcggtgcctcaattaacgggtgtgtgtggtcggatggaa
agattaagtgcatcaaaccaacctaccgcgattgtggattatgcacatacgccagatgcg
ttagagaaagctttgcaagcagcgcgattacattgtcaggggaaattatggtgtgtgttt
ggttgtggtggtgatcgtgatcgtggtaaacgtcctctcatggcgaaaattgcggagcaa
tttgctgatcacgtgattgtgacagatgataatccgcgtactgaatccgcggcgcaaatt
gtgcaagatattctggctggatttgaacatccgcaacacgttgaggtctgccacgctcga
gatcaagcgattattcaggcattacaaaaagcagatagcgatgatgtcgtactgattgcg
ggaaaagggcatgaagactatcaaattatcggcacacagaaacagcatttctctgatcaa
gaaaccgtacaacagtattttaaggtaaatcatcaccatgcttaa

DBGET integrated database retrieval system