KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1221Help
Entry
NT08PM_1221       CDS       T02057                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT08PM_1221
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT08PM_1221
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NT08PM_1221
Enzymes [BR:pul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NT08PM_1221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1288754..1290028)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFEQAVRQGLGKNQGLFFPETLPHFEDIDALLALPLVERSQKILSAL
IGEEISPTQLAKMVENAFTFPAPVAKVEEGVYALELFHGPTLAFKDFGGRFMAQALATVR
GEGKITILTATSGDTGAAVAHAFYGLENIDVVILYPQGKISPLQEKLFCTLGGNIRTIAI
NGDFDDCQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKAARDNLV
VSVPSGNFGNLTAGLIAKSLGLPIKRFVASTNVNDTVPRYLRSGNWQPHDTVATLSNAMD
VSRPNNWPRVEELFKRNGWALSELHSDAVNDNETEQTLKAMYAKGYLCEPHGAVAYRVLK
QDLQPGETGLFLCTAHPAKFKESVERILALELPLPDALAKHAALPLLSDIMENDFAKLRA
YLLA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacattaaacatccagaagaacaagtcaattttgagcaagcggtacgt
caaggattaggcaaaaaccaagggttattttttccagaaaccctaccgcactttgaggat
atagatgcgctgttagcgttaccattggtggagcgtagccagaagattttatctgcgtta
attggtgaggaaatttcgccaacccagttagcaaaaatggtagaaaatgcctttactttc
ccagcacctgtagcaaaagtggaagagggggtttatgcattggagttatttcatggtcca
accttagccttcaaagactttggtggtcgttttatggcgcaagccttagctacagtacgt
ggtgagggcaaaattacgattttaacggcaacgtcaggggatactggagcggcggttgcc
cacgctttttatggtttagaaaacattgatgtggtgattttatatccacaaggcaaaatc
agcccgctacaagaaaagttattctgtacgcttggtggcaatattcgtacgattgcaatc
aacggggattttgatgattgtcaggcattagtgaaacaagcgtttgatgatgcagagttg
cgtcaagcgattggcttaaactcagcaaattcgatcaatatcagccgtttattagcgcag
gtttgttattattttgaggcggttgcgcaattaccaaaagcagcacgcgataatcttgtg
gtatcggtaccaagtggtaactttggtaacctgaccgcaggcttaatcgccaagtcttta
ggcttgccaattaaacgttttgtggcgtcaaccaatgtgaatgataccgtaccgcgttat
ttacgcagtggcaattggcaaccgcatgacacggtggcgacgttatccaatgcaatggat
gtgagtcgtccaaataactggccacgggttgaagagttatttaaacgcaatggttgggcg
ctatcagagctgcattctgatgctgtaaatgacaatgaaacggaacaaaccttaaaagcc
atgtatgccaaagggtacttgtgtgaaccacatggtgcggtggcttatcgtgtgttaaaa
caagatttacagccaggcgaaaccggcttattcctctgtacggctcatcctgcgaaattt
aaagaaagtgttgaacgtattttagcgcttgaattacctttacccgatgcattagcaaaa
cacgcggctttaccgttgctttcggatatcatggaaaatgattttgctaaattacgtgcg
tatttgttagcttaa

DBGET integrated database retrieval system