KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1272Help
Entry
NT08PM_1272       CDS       T02057                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT08PM_1272
   01230 Biosynthesis of amino acids
    NT08PM_1272
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT08PM_1272
   00030 Pentose phosphate pathway
    NT08PM_1272
   00051 Fructose and mannose metabolism
    NT08PM_1272
   00052 Galactose metabolism
    NT08PM_1272
  Energy metabolism
   00680 Methane metabolism
    NT08PM_1272
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NT08PM_1272
Protein phosphatases and associated proteins [BR:pul01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NT08PM_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1335572..1336537)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAAGLEVYGIYEGYYGLYHNKVKQMTRYSVSD
IINRGGTFLGSARFPEFKDPAVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGIPGTIDNDVAGTDYTIGYQTALQTAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLAI
SAGIAGGCEYIVASEVEFNREELIQQIERSIIKGKRHAIIAITELICDVNELAREIESRV
KHETRATILGHIQRGGTPCAFDRILGSRMGVYAVDLLMQGKGGYCVGIQNEQLVHHDIID
AINNMRREFKADWLALSKRLD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaatagcagtattaaccagtggtggtgacgcaccgggcatgaatgccgcc
attcgcggcgtggttcgttcagcacttgcggcaggattagaagtatacggtatttatgaa
ggctattatgggttatatcataataaagtgaaacaaatgacccgttatagtgtttccgac
attattaaccgcggcggtacttttttaggatcggcgcgttttcctgaatttaaagatcct
gcggttcgcgctaaatgtgctgaaattttacgttcccatggtattgatgcacttgtggtg
attggtggggacggttcttacatgggggcaaaattactgacggaagaacatggtttccct
tgtgtcggtatcccgggtacgattgataacgatgtggcagggacagactacactatcggt
tatcaaaccgcattacagacagccgtcgaagccattgaccgtttacgcgatacctcaagc
tcgcaccaacgtatttcgattgttgaaatcatgggacgtcattgtagtgatttagctatt
tcagcgggtattgctggtggttgtgagtatattgtggcatcggaagtagaatttaaccgt
gaagagttaattcaacagattgagcgcagtattatcaaaggtaaacgtcatgccattatt
gcaattactgagttaatttgtgatgtgaatgaattagcccgtgaaattgaatcgcgtgtg
aaacatgaaacccgtgctaccattttaggtcatattcaacgtggcggtacgccttgcgca
tttgaccgtattttaggttcacgtatgggcgtttatgcggttgatttattaatgcaaggt
aaagggggctattgcgttggtattcaaaatgaacaattagttcaccacgatattattgat
gcaatcaacaatatgcgccgtgaatttaaagcggattggttagcattatcaaaacgttta
gactaa

DBGET integrated database retrieval system