KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1421Help
Entry
NT08PM_1421       CDS       T02057                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pul00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1479720..1480634)
Genome map
AA seq 304 aa AA seqDB search
MKKIVILGSTGSIGTSTLSVITHNPDKYQVFALVGGRNVELMFQQCLTFQPSFAALDDDV
AAKMLAEKLKAHQSKTTVLAGQQAICELAAHPEADMVMAAIVGAAGLLPTLSAVKAGKRV
LLANKEALVTCGQLFIDAVRESQAQLLPVDSEHNAIFQSLPPEAQRQIGFCPLSELGISK
IVLTGSGGPFRYTPLEQFEQITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFN
ASAEEMEVIIHPQSIIHSMVRYIDGSVIAQMGNRDILICVHRLRKPWHIQVGPLLALSPW
IFTN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcgttattttaggttcaactggatcaattggtaccagtactttatccgtg
attacacataatcctgataagtaccaagtgtttgcgttagttggtggacgtaatgtagag
ctaatgtttcaacaatgtttgacattccaaccgtcgtttgctgcgttagatgacgatgtc
gcagccaaaatgttggcggagaaactgaaagcccaccaaagcaaaacaacagtcttagca
ggacagcaagccatttgtgagttagcggcacatcctgaagcagatatggtaatggctgcg
attgtgggggcggcgggattattgcctactttgtctgcggtgaaagctggaaaacgtgta
ctattagcaaataaagaagccttggtaacttgcgggcaattatttattgatgcagtgcgt
gaatctcaagcacaattgttaccagtagatagtgaacataatgcgattttccaatctctt
ccgccggaagcgcaaagacaaattgggttttgcccgctttctgaattagggatcagtaag
attgtgttaacgggatccggcggtccattccgttatacccctctggagcaatttgaacag
atcaccccagcacaagcagttgcgcatcctaattggtcaatggggaaaaagatctctgtc
gattccgctaccatgatgaataaagggttggaatatattgaagcacgctggttatttaat
gcctcggcagaggaaatggaagttattattcatcctcaatccattattcattctatggta
cgttatatcgatggttccgtgattgcacaaatggggaatcgtgatatcctgatatgcgta
caccgattgcggaaaccatggcatatccaagtcggaccgttgctggcgttgagcccttgg
atttttaccaactga

DBGET integrated database retrieval system