KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1499Help
Entry
NT08PM_1499       CDS       T02057                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT08PM_1499
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NT08PM_1499
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NT08PM_1499
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NT08PM_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1562971..1564131)
Genome map
AA seq 386 aa AA seqDB search
MINGKLASILCDKNKKIEKMKIDKTLVVKFGTSTLTQGSAKLNLPHMMDIVRQLAQLHQA
GFRLVIVTSGAIAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQI
LLTRADIEDRERFLNARDTLRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQ
AEQLYLLTDQQGLFDRDPRKHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAA
DVATRSGIETIIAPGNRPNVIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITID
AGAENAMLMQHKSLLPAGIVNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGK
HSQDIEQVLGYEYGAVAVHRDDMIVL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgattaatggtaagttagcttcaattttgtgcgacaaaaataagaagatagagaagatg
aaaatcgacaaaacactcgttgtgaaatttggaaccagtacgcttacgcaaggatcagcg
aagttaaatttacctcatatgatggatattgtgcgtcagctcgcacagcttcatcaagcg
ggctttcgtttagtgattgtcacctcaggggcgattgcggcaggtcgtcattatttaaat
cacccgcaattgccaccgacgattgcctcgaaacaattattggcagcggtgggacaaagt
cagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcagatt
ttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatactttg
cgcgccttattagataatcagattattccagtgattaatgaaaatgacgctgtcgctacg
tcagaaattaaagtaggcgataacgataatttatccgcgttagtggcgattttagtgcaa
gcagaacagttgtatttgcttactgatcagcaaggtttgtttgatcgcgatccgcgcaaa
catccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcgatt
gctggcggaagtggcacctcgttaggcacaggcggcatgtccaccaaaatcagtgccgcg
gatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaatgtg
attgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagatcgc
ttagaaagtcgtaaacaatggctatatgcggcgccgtcagctggtattattaccattgat
gcgggggcggaaaacgcgatgttaatgcaacataaatcgttattgcctgctgggattgtg
aacgtggaaggacgcttttcacgcggtgaagtggtaaaaattcgtactcagcagggcaag
gatgtcgccttagggatgccacgttataacagcgatgcactccatttaattcaaggcaaa
cattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacaccgc
gacgatatgattgtgttataa

DBGET integrated database retrieval system