KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1499Help
Entry
NT08PM_1499       CDS       T02057                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT08PM_1499
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NT08PM_1499
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NT08PM_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1562971..1564131)
Genome map
AA seq 386 aa AA seqDB search
MINGKLASILCDKNKKIEKMKIDKTLVVKFGTSTLTQGSAKLNLPHMMDIVRQLAQLHQA
GFRLVIVTSGAIAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQI
LLTRADIEDRERFLNARDTLRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQ
AEQLYLLTDQQGLFDRDPRKHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAA
DVATRSGIETIIAPGNRPNVIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITID
AGAENAMLMQHKSLLPAGIVNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGK
HSQDIEQVLGYEYGAVAVHRDDMIVL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgattaatggtaagttagcttcaattttgtgcgacaaaaataagaagatagagaagatg
aaaatcgacaaaacactcgttgtgaaatttggaaccagtacgcttacgcaaggatcagcg
aagttaaatttacctcatatgatggatattgtgcgtcagctcgcacagcttcatcaagcg
ggctttcgtttagtgattgtcacctcaggggcgattgcggcaggtcgtcattatttaaat
cacccgcaattgccaccgacgattgcctcgaaacaattattggcagcggtgggacaaagt
cagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcagatt
ttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatactttg
cgcgccttattagataatcagattattccagtgattaatgaaaatgacgctgtcgctacg
tcagaaattaaagtaggcgataacgataatttatccgcgttagtggcgattttagtgcaa
gcagaacagttgtatttgcttactgatcagcaaggtttgtttgatcgcgatccgcgcaaa
catccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcgatt
gctggcggaagtggcacctcgttaggcacaggcggcatgtccaccaaaatcagtgccgcg
gatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaatgtg
attgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagatcgc
ttagaaagtcgtaaacaatggctatatgcggcgccgtcagctggtattattaccattgat
gcgggggcggaaaacgcgatgttaatgcaacataaatcgttattgcctgctgggattgtg
aacgtggaaggacgcttttcacgcggtgaagtggtaaaaattcgtactcagcagggcaag
gatgtcgccttagggatgccacgttataacagcgatgcactccatttaattcaaggcaaa
cattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacaccgc
gacgatatgattgtgttataa

DBGET integrated database retrieval system