KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1502Help
Entry
NT08PM_1502       CDS       T02057                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pul00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pul00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1565528..1566022
Genome map
AA seq 164 aa AA seqDB search
MTFSLIVAMTKNHVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
LVLSRQPYLHEGVIWQNSLESAVDFVKDSPEILLIGGGELFKQYLHKADKLYLTEIQTEL
EGDTFFPEIVWQDWQIEYEAWRQADEKNPYDCRFLILSRKTKNE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacctttagccttatcgtcgctatgacgaaaaaccatgtcattggtaaagacaatcaa
atgccttggcatctgcctgccgatttagcgtggtttcgccaaaataccacgggtaaaccg
gtgattatgggacgaaaaacctttgaaagcattgggcgtccattaccaaaacgcactaat
ttagtgctttctcgtcaaccatatctacatgagggcgtgatttggcaaaacagccttgaa
agtgcggtggattttgtcaaagattcacctgaaatcctgttgattggtgggggcgaatta
tttaagcaatatttacataaagccgacaagctctatctcactgaaatccaaacagaatta
gaaggcgataccttctttcctgaaattgtatggcaagactggcaaattgaatatgaagca
tggcgccaagccgatgaaaaaaatccttatgactgtcgctttttaattttatcgcgtaaa
actaaaaatgaatga

DBGET integrated database retrieval system