KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1582Help
Entry
NT08PM_1582       CDS       T02057                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT08PM_1582
Enzymes [BR:pul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NT08PM_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1655754..1656500)
Genome map
AA seq 248 aa AA seqDB search
MAVLVTRPDVRGAHLTEMLIQAGIFAIHLPLFTIETGRELNDLPNKLSQLKAGDYVFAVS
KHAVQYAADTLKNTGFFWRTDLVYFAVGQRSAEFFASQIERAVLYPYRQESSEGLLALDA
MQDLSEKHILILRGNGGREYFSEQAQLRGAKVETLECYQRVPTAYNNAEQISICKRAGIN
RLVISSAEILQYLVDFVPESEHNWLKSCQLVTVSQRIANLAKQLGWCDVVVSPRADNVHL
LKTLLSAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcggtattagtcactcgacctgatgtgcgaggcgcacacttaacagagatgttgatt
caagcggggatttttgcaatccatttaccgctctttacgatcgaaacaggacgagaattg
aatgacttgccgaataaactgtcgcaacttaaagcgggtgattatgtttttgcagtttca
aaacatgctgttcagtatgcagccgatacgttaaagaatacagggtttttttggcgaaca
gatttagtctattttgcggtaggacagcgcagtgctgaattttttgccagtcaaatcgaa
cgtgcagtattgtatccttatcgacaggaaagtagcgagggattattggcattggatgcc
atgcaagatttgtcagaaaagcacattttaattttacgcggcaatgggggacgtgagtat
ttttctgaacaggcacaattgcgtggtgctaaagtggagacgctcgaatgttaccagcgt
gtaccgactgcctacaataatgcagagcaaatcagtatttgtaagcgtgcaggaattaat
cggcttgtgattagcagtgcagaaattttgcagtatcttgtggattttgttccagaaagc
gaacataattggctaaaaagttgtcagctggtgacggtaagtcagcgtattgccaattta
gccaaacaattgggttggtgtgatgtggtggtttcaccgcgagcagataacgtgcattta
ctaaaaacattgctgtctgcggactaa

DBGET integrated database retrieval system