KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1740Help
Entry
NT08PM_1740       CDS       T02057                                 

Definition
phospholipase A1 (EC:3.1.1.32 3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT08PM_1740
   00565 Ether lipid metabolism
    NT08PM_1740
   00590 Arachidonic acid metabolism
    NT08PM_1740
   00591 Linoleic acid metabolism
    NT08PM_1740
   00592 alpha-Linolenic acid metabolism
    NT08PM_1740
Enzymes [BR:pul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NT08PM_1740
    3.1.1.32  phospholipase A1
     NT08PM_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1811302..1812174
Genome map
AA seq 290 aa AA seqDB search
MYKAKGINLYKKCLILAVLGVFVSHGTQANESDARPYKSKAEVLLTKSDAFIGLLGYEEN
YLMGTYSNRHFLKREKTQKDEIKFKISLALPLWRGILGNNSVLAASYTQKSWFQLSNVDD
SSPFRETNYEPQLFLAWKTQYSLPFGWTLQDVEAGINHQSNGRDDAEKLSRSWNRLYVRA
SAIKQNWTVEIKPWWRIPEKAKNDDNPDITKYRGHFDIALGYYYHDHQFKLSGHYNPISN
KGGLEASYSYPITKNIRFYTQYYNGYGESLIDYQQRIQRIGIGISLNNVF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagcaaaaggaattaacctgtacaaaaaatgccttatcttagcagtgttaggc
gtctttgttagccatggtacacaggcaaatgaaagtgacgcgcgtccctataaaagtaaa
gcagaagtcttattaaccaaatcagatgccttcatcggcttacttggctacgaagaaaac
tatctgatggggacctattcaaacaggcattttcttaaacgcgaaaaaacgcaaaaagat
gagattaagttcaaaattagcttagcacttcccctttggcggggtattttgggcaataat
tccgtattagccgcctcttatacacaaaagtcctggtttcagctaagtaatgttgatgat
tcttctcctttccgcgaaaccaattacgaacctcagctatttttggcttggaaaacgcaa
tattccttaccttttggctggacattacaggatgtggaagccgggataaatcatcaatcc
aatgggcgcgatgatgcggaaaaactctctcgcagttggaatcgcctctatgtgcgtgcc
tctgccataaaacagaattggacagttgaaatcaaaccttggtggcgtattcctgagaaa
gccaaaaatgatgataacccagacatcactaaataccgcggtcattttgatatagcgttg
gggtactactatcacgatcatcaatttaaactttcaggtcactataatccgatctcaaac
aaagggggattagaggcaagttatagttacccaatcacaaaaaacattcgtttctacact
caatactataatggctatggtgaatccttaattgattatcaacaacgtatccaacgtatt
ggtatcggcatttccttgaacaatgttttctag

DBGET integrated database retrieval system