KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1967Help
Entry
NT08PM_1967       CDS       T02057                                 

Definition
(GenBank) PldB protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
pul00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT08PM_1967
Enzymes [BR:pul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NT08PM_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: AFI47069
Position
complement(2052239..2053192)
Genome map
AA seq 317 aa AA seqDB search
MIREPHFTHFALAELHPFAAQFPLQDVQGKKGVRITYRHFVQDNPVQRNLVILVNGRAEN
LLKWTELAYDFYQQGYDVLVFDHRGQGYSQRLLPDHEKGYIDEFRFYADDMAILLAKISA
LYPYENQHILAHSLGALISTYYLANYDHQVKSAVFSAPFYGIPLKHSFRDELIINLMMLL
GQGSRYVFGKGRYQPADLDNNDLSCCRTRMRWMNRINRRYPHIHLGGPTFRWVHLCFSAI
KKLPTILPRIEIPVLILQSEKEKIVENKNLRKLTALLPRGELTQIAQSKHEILFERDLIR
SEALKKISQFFTANSAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgaaccccattttactcactttgccttggctgaattacatccttttgcagca
caatttccgttgcaagacgtacaagggaaaaaaggggtacgtattacctatcggcatttt
gtacaagacaatcccgtacagcgtaatttggtgattttagtcaatggacgtgcagaaaac
ttattgaaatggactgaactggcttatgatttctatcaacaaggctacgacgtcttggta
tttgatcatcgtgggcaaggctattcacagcgtttattgccagatcatgagaaaggttat
attgatgagtttcgtttttatgcggacgatatggcgattttattagcgaaaatcagcgca
ctttatccttatgaaaatcaacatattctcgcccattccttaggtgcattgattagtact
tattaccttgccaattacgatcatcaggtgaaaagtgcggtcttttctgcgccattttat
ggcattcctctcaaacattctttccgagatgagctcattattaatctaatgatgttatta
ggtcagggttcacgctatgtgtttggcaaaggacgttatcaaccggcggatttggataat
aatgatttaagttgttgtcgaactcgtatgcgctggatgaatcgaattaatcgtcggtat
ccgcatattcatttagggggaccgaccttccgttgggtgcatttatgttttagtgccatt
aaaaaattaccgactattttgccgcgtattgagattcctgtgctgattctacaatcggag
aaagaaaagattgtggaaaataaaaatctgcgcaaactcaccgcacttttaccacgagga
gagttaacacaaattgcgcaaagtaaacacgaaattttatttgagcgtgatcttatccgc
tccgaggcactcaagaaaattagccaattttttactgccaatagcgccaaataa

DBGET integrated database retrieval system