KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1973Help
Entry
NT08PM_1973       CDS       T02057                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
pul00010  Glycolysis / Gluconeogenesis
pul00051  Fructose and mannose metabolism
pul00562  Inositol phosphate metabolism
pul01100  Metabolic pathways
pul01110  Biosynthesis of secondary metabolites
pul01120  Microbial metabolism in diverse environments
pul01130  Biosynthesis of antibiotics
pul01200  Carbon metabolism
pul01230  Biosynthesis of amino acids
Module
pul_M00002  Glycolysis, core module involving three-carbon compounds
pul_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT08PM_1973
   00051 Fructose and mannose metabolism
    NT08PM_1973
   00562 Inositol phosphate metabolism
    NT08PM_1973
Enzymes [BR:pul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NT08PM_1973
Exosome [BR:pul04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NT08PM_1973
  Exosomal proteins of bladder cancer cells
   NT08PM_1973
  Exosomal proteins of melanoma cells
   NT08PM_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PTS_EIIB
Motif
Other DBs
NCBI-ProteinID: AFI47075
Position
complement(2057776..2058825)
Genome map
AA seq 349 aa AA seqDB search
MEKKIYFGTNLKMYKGNCETVDYLTQLLALREKLQSDYDIELFVIPSYIALKDAVHAAAS
ETTHKILIGAQNMNAKDKGQFTGEISPLMLKELGVQLVMIGHSERRHVLKETDQEENEKV
LSALKHGFKTLLCVGETLEQKNYQISDEVLRTQLKIGLHGVSVKQLPHLFIAYEPVWAIG
EGGIPATAQYADEKQKIIKQCLFEMFGEESKKIPVLYGGSVNLENANELIMQPHIDGLFV
GRSAWDAQCFYTLIDGALKALAGTTHQFSPIATQLIKHLGGKENISALTHCASRIRVMTR
NENHINKVAIEKINGVSGLFSIANQYQIIVGPKWVEKIYSEMKALLETE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaaatttactttggtacaaatttaaaaatgtataaaggtaattgtgaaaca
gtcgattaccttactcagttacttgccctcagagaaaaacttcaatctgattatgatatt
gaattatttgtcattccttcttatatcgccttaaaagatgctgtacatgcagcggcatca
gagacaacgcataaaattcttattggtgcacagaacatgaatgctaaggataaggggcag
tttactggcgaaatttcaccactcatgttgaaagagctaggggttcagttggtcatgatt
gggcattctgaacgtcgccatgttttgaaagaaaccgatcaggaagagaatgagaaagta
ttgtcagcgttgaagcatggctttaaaacattactctgtgttggtgaaacgttagaacag
aaaaattatcagatttccgatgaagtacttcggacacaattaaagattggtttgcacggt
gtatcagtgaagcaattacctcatttattcattgcatatgaacccgtttgggcaattggt
gaaggtggtattcctgcaacggcgcaatatgcagatgagaaacagaagatcattaaacaa
tgtttatttgaaatgtttggtgaggaaagtaaaaagataccggtattgtatgggggaagt
gtgaatttagaaaatgcaaatgaattaattatgcagcctcatattgacggattgtttgtt
gggcgtagcgcctgggatgcacaatgtttttataccttaatagacggtgcgttaaaagcc
ttggcgggtacaacacatcaatttagccctattgctactcagctcattaaacacttagga
ggaaaagaaaatatcagtgcgttaacgcattgtgcgagtcggattagagtgatgacgcgg
aatgaaaatcatataaataaagtagcaatagaaaaaataaatggggtgagcgggttattt
tcgatcgctaatcaatatcaaattattgtaggtcctaaatgggtagaaaaaatttatagc
gaaatgaaagcgttattagaaacagaatag

DBGET integrated database retrieval system