KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_2029Help
Entry
NT08PM_2029       CDS       T02057                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NT08PM_2029
Enzymes [BR:pul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NT08PM_2029
Exosome [BR:pul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT08PM_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108314..2109339
Genome map
AA seq 341 aa AA seqDB search
MTQQIFASFPQRRLRRMRKQAFSRRLMAENKLSVEDLIYPVFIIEGEKQREPVPSMPGVE
RLTIDELLIEAELLVKYGVPVIALFPVIAQEKKSLMAEEAYHPDGLVQRAVKALKDKFPT
ELGILTDIALDPYTTHGQDGIIDQHGYVLNDVTSDILVKQALSHAKAGADIVAPSDMMDG
RIGKIRHALEEKGFINTLIMAYSAKYASHYYGPFRDAVGSATNLKGGDKKTYQLDPANSD
EGLQEVALDLQEGADMVMVKPGMPYLDLVYRVKTHFGVPTFAYQVSGEYAMHQAAIQNGW
LKEKECIMESLLCFKRAGADGILTYYAKQVAEWLYWEKQHQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaaatttttgccagtttccctcaacgtcgcctacgccgtatgcggaaacaa
gctttcagtcgccgtttaatggcagaaaataaactcagcgtagaggatttaatttatcct
gtttttattattgaaggcgaaaagcaaagggaacccgtaccttccatgcctggtgtagaa
cgcttaaccattgatgagctattaattgaagccgaacttttagtcaaatatggggtgccg
gtgattgcgcttttcccggtgattgcacaagagaaaaaatccttaatggcagaagaagct
tatcatcctgatggcttagtacagcgcgcggtaaaagcattaaaggacaaattcccaact
gaacttggcatacttactgatattgccctcgatccctatactacacacggacaagacggg
ataattgatcaacatggctatgtgttaaatgatgtcactagcgatattttggtcaaacaa
gcactttcccatgcgaaagcgggcgcagatattgtagcaccaagcgatatgatggacggt
agaattggcaaaattcgccatgccctcgaggaaaaggggtttatcaatacactcattatg
gcgtattctgccaaatatgcttctcattattatggacctttccgcgatgccgtcggttct
gccaccaatttaaaagggggcgacaaaaaaacttatcaattagatccggccaatagtgat
gaaggactacaagaagtggcattagatttacaagaaggggcagatatggtgatggtcaaa
cccggcatgccgtatttagatttggtttatcgcgtgaaaacccattttggcgtgccaact
ttcgcttaccaagtatcgggtgagtatgccatgcatcaagctgcgatccaaaacggctgg
cttaaagaaaaagaatgtattatggagtccttattgtgtttcaaacgtgctggcgccgat
gggattttgacgtattacgccaaacaagtggcagaatggctatattgggaaaaacaacat
caataa

DBGET integrated database retrieval system