KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_2149Help
Entry
NT08PM_2149       CDS       T02057                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT08PM_2149
   01230 Biosynthesis of amino acids
    NT08PM_2149
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT08PM_2149
   00051 Fructose and mannose metabolism
    NT08PM_2149
   00562 Inositol phosphate metabolism
    NT08PM_2149
Enzymes [BR:pul01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NT08PM_2149
Exosome [BR:pul04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NT08PM_2149
  Exosomal proteins of bladder cancer cells
   NT08PM_2149
  Exosomal proteins of melanoma cells
   NT08PM_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2223581..2224366
Genome map
AA seq 261 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKALIEDLKTELAGVEGCDVAIAPPVMYLAEAEAALKCSCS
CGGKAIALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKF
AALKQAGLVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAEAFNGAVIAYEPIWAIG
TGKSATPAQAQAVHAFIRSHIAKKDNAVAEQVIIQYGGSVNDANAAELFTQPDIDGALVG
GASLKAPAFAVIVKAAAKAKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacc
aaagcattaatcgaagacttaaaaacagaattagcgggtgttgaaggctgcgatgtggca
attgccccaccggtgatgtatttagcagaagcagaagctgccttaaaatgcagttgtagt
tgtggcggaaaagccattgcccttggtgcacaaaacgtcgatgtgaatgtacaaggcgcc
tttactggcgatatttcaacagaaatgctgaaagattttggtgcaaaatatatcattatc
ggtcactctgagcgtcgtacttatcataaagaaagcgatgaattcatcgcgaaaaaattc
gcggcattaaaacaagcaggcttagtgccggtattgtgtatcggtgaaagtgaagccgaa
aatgaagcgggcaaaacagaagaagtatgcgcacgccaaattgatgccgtattaaataca
ttaggcgctgaagcctttaatggtgccgttatcgcgtatgagccaatttgggcaatcggt
accggtaaatcagcaacccctgctcaagcacaagcagttcatgcctttatccgcagtcat
atcgcgaaaaaagacaacgcggtagcagaacaagtgatcatccaatacggtggttcagtt
aatgatgcaaatgcggctgaattatttactcaacccgatatcgatggtgcattagttggt
ggtgcctcattaaaagcccctgcctttgctgtgatcgtcaaagccgcagcaaaagcgaaa
aactaa

DBGET integrated database retrieval system