KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_2149Help
Entry
NT08PM_2149       CDS       T02057                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:pul01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pul01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pul00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pul00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pul00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2223581..2224366
Genome map
AA seq 261 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKALIEDLKTELAGVEGCDVAIAPPVMYLAEAEAALKCSCS
CGGKAIALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKF
AALKQAGLVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAEAFNGAVIAYEPIWAIG
TGKSATPAQAQAVHAFIRSHIAKKDNAVAEQVIIQYGGSVNDANAAELFTQPDIDGALVG
GASLKAPAFAVIVKAAAKAKN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacc
aaagcattaatcgaagacttaaaaacagaattagcgggtgttgaaggctgcgatgtggca
attgccccaccggtgatgtatttagcagaagcagaagctgccttaaaatgcagttgtagt
tgtggcggaaaagccattgcccttggtgcacaaaacgtcgatgtgaatgtacaaggcgcc
tttactggcgatatttcaacagaaatgctgaaagattttggtgcaaaatatatcattatc
ggtcactctgagcgtcgtacttatcataaagaaagcgatgaattcatcgcgaaaaaattc
gcggcattaaaacaagcaggcttagtgccggtattgtgtatcggtgaaagtgaagccgaa
aatgaagcgggcaaaacagaagaagtatgcgcacgccaaattgatgccgtattaaataca
ttaggcgctgaagcctttaatggtgccgttatcgcgtatgagccaatttgggcaatcggt
accggtaaatcagcaacccctgctcaagcacaagcagttcatgcctttatccgcagtcat
atcgcgaaaaaagacaacgcggtagcagaacaagtgatcatccaatacggtggttcagtt
aatgatgcaaatgcggctgaattatttactcaacccgatatcgatggtgcattagttggt
ggtgcctcattaaaagcccctgcctttgctgtgatcgtcaaagccgcagcaaaagcgaaa
aactaa

DBGET integrated database retrieval system