KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_2176Help
Entry
NT08PM_2176       CDS       T02057                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NT08PM_2176
   00052 Galactose metabolism
    NT08PM_2176
   00500 Starch and sucrose metabolism
    NT08PM_2176
   00520 Amino sugar and nucleotide sugar metabolism
    NT08PM_2176
Enzymes [BR:pul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NT08PM_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2251165..2252052)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGMKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLDEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVILPDVLLADFSADQKRENLAAMVKRFEETQTSQIMVAPVAEKEVSSYGIVDCGGA
DLKGGESTKIHSIVEKPSLDKAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKEVVEAFHMTGKSFDCGDKIGYMQAFVEYGLQHDKLGQQFKAYLQQLVKSF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattatccccgtcgcaggtttagggacacgaatgttacccgcgacaaaggcg
attcctaaagaaatgttaacgctggtggataagccgttaattcaatatgttgtgaatgaa
tgcgtggctgctggtatgaaggaaattgtcttggtgacacattcttcaaaaaatgccatt
gaaaaccattttgatacctcatttgaattggagacaatgctagaaaaacgtgttaaacgt
caacttttagatgaggttcgctcgatttgtccaaaaaatgtgacaattatgcatgtccgt
caaggtaatgcgaaaggcttaggacatgccgttttatgtggcagaccattagttggaaat
gagccatttgctgtgattctaccggatgtactattggctgatttttcagcggatcaaaaa
cgtgagaatctggctgcaatggttaaacgttttgaggaaacacaaacgagccagattatg
gttgcgcctgttgctgaaaaagaggtcagtagctacggtatcgtagattgtggcggagct
gatttaaaaggtggcgaaagtacaaaaattcatagtattgttgagaaaccgagtttagac
aaagccccttctaatttagcggtggttggacgttacgttttctcagcggcaatttgggac
ttgttggaaaaaactccgattggtgtcggcgatgaaattcaattaaccgatgcgattgat
atgttaattgaaaaagaagtcgttgaagcgttccatatgacaggaaaatccttcgattgt
ggtgataaaattggttatatgcaagcgtttgtggagtatggattgcagcatgataaatta
ggtcagcaattcaaagcgtatttgcaacagctcgtcaaaagtttttaa

DBGET integrated database retrieval system