KEGG   Pusillimonas sp. T7-7: PT7_0008Help
Entry
PT7_0008          CDS       T01486                                 

Definition
D-alanyl-D-alanine ligase
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
put  Pusillimonas sp. T7-7
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PT7_0008
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PT7_0008
Enzymes [BR:put01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     PT7_0008
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     PT7_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8555..11359
Genome map
AA seq 934 aa AA seqDB search
MTLMNAQEVISWLSRHVSPKAQLCLDTRQLSAGDVFFACVGLTGDGRDYIAQAVEAGAAA
IVMQADDRASATPAIDVPVLAVPDLPGQLGSIGHLWYDRPSEDMSVVAVTGTNGKTSCVQ
WLAAALNAEGTPCGTIGTLGVTLPNGNNLGGVLTTPDVLSMHRSLATMRAAGAQVVALEA
SSIGLDQGRLDQVRIVIAAFTNLTHDHLDYHGTLDNYQRAKFSLFAWPGLRGAVVNVDDP
AGKQLVSTLPPASTLAYSISGHAEATIQAQDIHAGRYGLVFNVVTRDGAVQLLTRLVGEH
NVANLLLVTGVLQQLGWDLSRIARVLSTLRSVEGRLQVVDALGAVGAAHGQAMVVVDYAH
TPDALKRALLALRDVARVRGGKLICVFGCGGSRDRSKRPMMGRIAVELADEVVLTNDNPR
LEEPLDIIAQIKSGMSTAARVELDRALAILSSIWAADAHDVVLLAGKGHETYQEFQGQRV
PFDDREWARFALSWQQGMSISTDTRSIAKGQLFVALKGEAFDGHAYLATALEAGACAAVV
EHKDTAVALPQFVLGDTRQALIRISTLWRRQHDLPVVAVTGSNGKTTTKEMIASIFRQSP
GEEASLATRGNLNNDIGVPLTVLRLNRQHRAAVFELGMNHPGEISLLAGIAQPTVALVNN
AQREHQEFMLTVEAVARENGTVIDMLPVDGIAVFPGDDAYSDLWAELAGTRTVLRFGFSP
DFDVYADQIHAEPTHTVCCIHTPIGSATLALASPGVHNLRNALAAAACAFATGVPLESIV
QGLEAFNPVSGRMQPHALAGGYQLIDDTYNANPDSVRAAIDVLAELDGKRVLVLGDMGEV
GANGDAMHAEVGAYAHERGIDVLLAFGTACVHAVQAFGAGGQSFTSIEALNSRLLTEMPA
HILVKGSRSTRMERVVRALEKEMINHEEGVRHAT
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgacactcatgaatgcacaagaggtcatttcatggttgagccggcatgtgtcgcccaaa
gcgcaactgtgcctggatacccgtcagctgtctgctggcgatgtgttttttgcttgtgtc
ggcctgactggcgatggccgcgattacattgcacaggctgttgaggccggtgcggcggcg
attgtgatgcaggctgatgatcgggcgagcgctacgccggcaatcgatgtgcctgtgctt
gcggtaccggatctgccggggcagctgggatccatcgggcatctttggtatgaccggcct
tcggaagacatgtccgtggtggccgtcaccggcacaaatggcaagaccagctgcgtgcaa
tggctggcagccgccctgaacgccgaagggacgccttgcgggacgataggcacgctgggc
gtgacgctacccaatggaaataatcttggcggtgtgctgactacccccgacgtgctgagc
atgcatcgcagcttggccaccatgcgtgcagcgggagcccaggttgtggccctggaggcg
tcgtcgatagggctggaccagggccgccttgatcaggtgcgcatagtgattgccgcgttc
accaacctgactcacgaccatcttgattaccacggcacgctggataactaccaacgcgcc
aagttttccctattcgcctggccaggcctgcgtggcgccgtagtcaatgttgacgaccct
gccggcaagcagttggtttcgacattgccgccggcttcaacgctggcttattctatttca
ggccatgcagaggcaacgatccaggcgcaagatatccatgccgggcgctatggcctggtc
ttcaacgtggtgacgcgtgatggtgctgtgcagttgcttacccggcttgttggtgagcac
aatgtagcgaatttgctgttggtaacaggcgtgttgcagcaactgggttgggatttgtcc
cgtatcgcacgagtcttgtcaacactgcgttctgtcgaggggcgcttgcaagtggtggac
gccttgggcgccgtcggtgctgcgcatggccaggccatggtggttgttgactatgctcat
acgcccgatgccctgaagcgcgcgttgcttgccttgcgcgatgtcgcccgtgttcggggc
ggtaaattgatatgtgtatttggctgcggcggtagccgtgatcgcagcaagcggcccatg
atggggcgcattgccgttgagctggccgacgaggtcgtgctgaccaacgataacccgcgt
cttgaagagccgctggacatcatcgcgcagatcaagtcgggcatgtcaaccgcagcgcgg
gtcgagctggatcgtgctctggcgattctgtcttccatctgggcagctgatgcgcatgat
gttgtgttgctggccggcaaggggcatgaaacctatcaagagtttcagggtcagcgtgtg
ccattcgatgaccgtgagtgggctcgttttgccttgtcgtggcaacaagggatgagtatc
tcgaccgacacccgcagtattgccaaggggcagttgtttgtcgccctgaagggcgaggcc
ttcgatgggcatgcctacctggctaccgcgcttgaggctggcgcttgtgcggctgtggtc
gagcataaggataccgctgtggcgttgccgcagtttgtgctgggcgatacgcgccaggcg
ttgatacgcatcagtacgctctggcgccggcagcatgatttgccggtggttgccgtaacg
ggcagcaatgggaaaaccacgaccaaagagatgattgcctcaattttcaggcaatcgccg
ggcgaggaggccagtctggcgacccgcggcaacttgaataatgatattggcgtaccactg
acggtactgcgtttgaaccgccagcatcgcgctgccgtgtttgagctgggcatgaaccat
cctggcgaaatatctttgttggcaggtattgcccagcctacggttgccctggtcaataac
gcccagcgagagcatcaggaattcatgctgactgtcgaggcggtggcccgagagaacgga
acggtcatcgatatgttgccggttgacggcattgccgtgttcccgggcgatgatgcctat
tctgatttatgggccgagctggctggaacgcgcacggtactgcgtttcggattttcgcct
gattttgatgtgtatgccgaccagattcatgccgagcctacccatacagtgtgctgcatc
catacgccaattggcagcgccacacttgccttggcgtctcctggcgtgcataacttgcgc
aatgcgcttgccgcagccgcgtgtgcctttgccaccggtgtgccgctggaaagcatcgtg
caagggcttgaggctttcaatcccgtgtcgggccgtatgcagccgcacgcattagcgggc
ggttatcagctcatagacgatacctacaacgccaaccccgattcggtccgtgcggccatc
gatgtgttggccgaacttgatggcaagcgtgtgttggtgctgggtgatatgggtgaagtg
ggcgcaaacggtgacgccatgcatgcggaagtgggtgcttatgcccatgagcgcgggatt
gatgtcttgctggcctttggtactgcctgcgtacatgcagtccaggcgtttggcgccggc
ggacagtcatttacctccatcgaggcgctgaacagccggttgctgaccgaaatgcctgca
catattctggtgaaggggtcgcgtagtacgcgcatggagcgcgttgtccgcgctcttgaa
aaagaaatgatcaatcacgaagaaggggtacgccatgctacttga

DBGET integrated database retrieval system