KEGG   Pusillimonas sp. T7-7: PT7_0092Help
Entry
PT7_0092          CDS       T01486                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
put  Pusillimonas sp. T7-7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:put03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101049..101657
Genome map
AA seq 202 aa AA seqDB search
MESPLPEPEPLTSLIEALRRLPGVGVRSARRMAYHLLQYDISGAEQLSRALASAAQGLRH
CARCNGFAEEDVCATCTNPKRDPSLLCVVETPADQNMIESSHGYRGLYYVLMGRLTPLEG
VGPRALQFDRLIQRVSDGIVQEVILATNFTAEGETTAHYLSELLRARGLTVSRLARGVPA
GSELEYVDAGTIAWALMERRNA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgccgctacccgagccagagccgctcaccagccttattgaagcattgcgccgc
ttgcccggcgtgggtgtgcgctcggcccgccgtatggcctaccacctgcttcaatacgat
attagcggagcggagcagctaagccgtgccctggcctcggcggcacaggggctgcgccac
tgtgcccggtgtaatggttttgcagaagaagacgtgtgcgccacgtgtaccaaccccaag
cgtgacccatccttgctgtgtgtcgttgaaaccccggccgatcaaaacatgatcgagtcc
agccatggctatcgcggcttgtactatgtattgatgggacgcttgacgccgcttgaaggc
gttggtccgcgggcattgcaattcgaccgtcttatacagcgggtcagcgatggcatagtg
caagaagtcattttggccaccaacttcacggccgaaggcgaaacgactgcacattatctt
tccgagctcttgcgtgcccggggcctgacggtttcccgtctggctcggggcgtaccggcc
ggtagtgaacttgagtatgttgatgcgggcaccatcgcatgggccctgatggaaagacgc
aatgcctga

DBGET integrated database retrieval system