KEGG   Pusillimonas sp. T7-7: PT7_0112Help
Entry
PT7_0112          CDS       T01486                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
put  Pusillimonas sp. T7-7
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PT7_0112
Enzymes [BR:put01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PT7_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124248..125033
Genome map
AA seq 261 aa AA seqDB search
MGIVNVTPDSFSDGDQHFQTDEAIAHARLLIEQGADILDIGGESTRPGAEPVPAQEELKR
ILPVIEALRSADIPLSIDTFKPEVMRKALDAGADLINDIYGFRQPGAIEAVADSSCGLCV
MHMQGEPKTMQRTPQYDDVMRDVQQFLHERVSVMLAAGIDKRRITLDPGFGFGKTPEQNY
RLLRRLQELDSLGCPWFIGLSRKSMIGHVTGRVPAERVAGSIAAALAAVARGAHIIRVHD
VAETVDAVKVWSAIEHGAFYD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgtcaacgtcactcctgactcgttttcagatggcgatcagcatttccagacc
gacgaggctattgcccatgcccggctgctgatcgagcagggcgccgatattcttgatatt
ggcggcgagtcgaccaggccaggcgctgagccggtaccggctcaagaagaactcaagcgc
atcctgcctgtcatagaagccttgcggtcggccgacatccccctttccattgataccttc
aaacccgaagtcatgcgcaaagcgcttgatgccggcgcagaccttatcaacgatatctac
ggtttccggcaacccggggccatagaagctgttgctgattcaagctgcggtttatgcgtc
atgcatatgcagggcgagcccaagaccatgcagcgcacgccgcagtatgacgatgtcatg
cgcgatgttcagcagttcctgcacgaacgcgtgtcggtcatgctggctgccggcatagac
aagcggcgtatcaccctggatccgggttttggctttggcaagacccctgaacaaaactat
cgtctattacgtcggctgcaagaactggacagcctgggttgcccttggttcatcggccta
tcgcgcaaatccatgattggccatgtgaccggccgggtcccagccgaacgggtggcaggc
agcattgccgccgctttggcggctgtggcgcgcggggctcatataatccgtgtgcacgat
gttgccgagacggtagatgcggtaaaagtatggagtgcaattgaacacggagctttttat
gactga

DBGET integrated database retrieval system