KEGG   Pusillimonas sp. T7-7: PT7_0129Help
Entry
PT7_0129          CDS       T01486                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:put01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:put00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:put00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:put00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:put00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142514..144151
Genome map
AA seq 545 aa AA seqDB search
MLPLNPKSYDDISQRFSWDIPPRYNIGVDVCDKWAEQDSARLALIHIGHDGAVRNCSFGE
LLEMSNRVGNLLLAQGVEPGDRVGILLPQAPETAFGHIAAYKTGCIAIPLFALFGVEALL
YRLKDSGARVVITNAEGAAKLAQIGDQLPDLQVVFTIDGAHDGTLDLHREAARHSSDLTP
VDTAADDPAVIIYTSGTTGQPKGALHAHRVLLGHLPGVEISHNLFPQEGDRMWTPADWAW
IGGLFNVLLPSWHHGIAVVAHRFQKFTPEAAFQLIQDHGIRNTFLPPTALKMMRTVAEPE
KRWNYQLRSVASGGESLGAELLDWGRRTFGLTINEFYGQTECNMTVSSCADLMPVSPGAI
GRPVPGHRVAIIDEGGNVLGPGETGNIAVHSPDPVMFLQYWNNTRATREKYIGEWLVTGD
TGSVDDDGYIHFMGRNDDVITSAGYRIGPGEIEDCILQHASVKMVAVVGAPDPQRTEIVA
AVIVLKETYEANEALKREIQDYVKTRLAAHEYPREIFFVDELPMTTTGKVIRRELRQQVE
AWRQA
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttgccattgaatcccaagagctacgacgatatcagtcagcgtttttcctgggacatt
ccgccgcgctacaacatcggggtcgatgtatgcgacaagtgggccgaacaagactcagcg
cgcctggccttgattcatatagggcacgatggcgctgtccgaaactgcagttttggcgag
cttcttgaaatgtcgaaccgtgtcggcaatctgctcctggcgcagggggtcgagcccggc
gacagggtgggcattcttctgccccaggcgcccgaaaccgcatttggtcatattgccgcc
tataaaacaggctgtatcgccattccgctgtttgcgctatttggggtcgaggccctgtta
tatcgtttgaaagacagcggtgcgcgtgtcgttatcaccaatgccgagggcgccgccaag
ctggctcaaataggcgaccaattacccgatttgcaggtcgtgttcaccatagatggcgcc
cacgatggcactctggacctgcaccgcgaggccgcaaggcatagctcagacctgacgccg
gttgatacggcggctgatgatcccgcagtcattatctacacctctggcacgaccggccag
cccaaaggcgccttgcatgcacatcgcgtgctgctgggccatttgccgggcgtggaaatt
tcacataatctttttccgcaggaaggcgaccggatgtggacgccggccgattgggcctgg
atcggcggtttgttcaatgttctgctgccgtcctggcatcacggtattgcggtcgttgcg
caccgtttccagaagttcacacccgaagcggcttttcagcttattcaagatcacggtata
cgcaatacctttttgccacccacggccttgaaaatgatgcgtacggtggccgagcccgaa
aaacgctggaactaccaattgcgttccgtggccagcggcggcgagtcgctgggcgccgag
ctgttggactgggggcggcgcaccttcggcctgaccatcaatgaattctacggccagacc
gagtgcaatatgaccgtgtcgtcttgcgccgacctgatgcctgtcagccccggagccata
ggccggcctgtcccgggccaccgggtcgccatcatagacgagggcggcaatgtgcttggc
cctggcgaaaccggcaatattgccgtacatagtcccgatcccgtcatgtttttgcagtac
tggaacaatactcgggcaacccgggaaaaatacataggcgagtggctcgttaccggcgat
accggcagcgtggatgacgatggctatattcatttcatgggccgcaacgacgacgtcatt
acttcggcgggctatcgtattggtcctggcgagatcgaagactgcatactccagcatgcg
tcggtcaaaatggtggccgtggtcggggcgcccgacccgcagcgcaccgagattgtggca
gccgtgatcgtgctgaaagaaacttacgaagccaatgaggcgctcaagcgggaaatacag
gactatgtaaaaacccggctggccgcgcatgagtatccgcgcgaaatattttttgtggac
gagcttcccatgaccaccacgggcaaggtcattcgtcgcgaactgcgccagcaagtcgag
gcatggcgccaagcctaa

DBGET integrated database retrieval system