KEGG   Pusillimonas sp. T7-7: PT7_0158Help
Entry
PT7_0158          CDS       T01486                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
put  Pusillimonas sp. T7-7
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PT7_0158
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PT7_0158
Enzymes [BR:put01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     PT7_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179592..180890
Genome map
AA seq 432 aa AA seqDB search
MTVTDTHKQENAVVVVETDSAKDTDKAAQGLIARLSRWLDRDHLPAPLEVQTLFSARLTD
VAANRLAKQWSARYLAADAKERRALLTGLTQASSGLEPREDQGLRMFRRLYAQAESLNLL
VELRADMLRWRKQVSGLGVLERELEGLLSSWFDVGMLELRPITWDSPASLLEKLIQYEAV
HEIRSWEELKHRVADHRRCYAFFHPRMQDVPLIFVEVAFASQMAGNVQVLLDPQAPPDDT
GKARWAIFYSISNTQPGLRGISFGNFLLKRVIDELLRELPRLKSFATLSPIPGFAEWLGK
QDGKALQDLLNDKADKQQALDDPEAGLKWVDRLKSAAAGQASDAVQRTGLRLAVQYLKTM
KNGQPLDPVARFHLGNGARIERVNWAADCSAKGMTQSCGVMANYLYELDQLDDNLAQLAA
GKPRLGMNLRWR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaccgatacgcacaagcaagaaaatgcagttgtcgtagttgaaaccgatagc
gctaaagatactgacaaggcggcgcaaggcttgattgcccgattaagccgctggcttgac
cgcgaccatcttccggctccgcttgaagtgcaaaccttgttctcggcacggctgactgac
gtggcggccaatcggctggcaaaacaatggagtgcccgctatttggccgctgatgccaaa
gagcgtcgggctctgctgaccggtctgacgcaagccagcagcggccttgagccgcgggaa
gatcaggggctgcgtatgttcaggcgtctttatgcgcaggcggaaagcctgaatttgctg
gtggaactgcgcgccgatatgctgcgctggcgcaaacaagtgtcgggcctgggcgtgctc
gagcgtgaacttgagggcttgctgtccagttggtttgatgtgggtatgcttgagctgcgc
cccattacctgggactcgcccgcctctttactcgaaaaacttattcagtacgaggcggtg
catgaaatccgttcctgggaagagctcaagcacagggtggccgatcaccgccgttgttac
gcatttttccaccctcgcatgcaagacgttcccctgatattcgtcgaggttgcatttgcc
tcgcagatggccggcaatgtgcaagtgttgcttgatccgcaggcgccgccagacgatacc
ggcaaagcgcgctgggccattttttattccatttccaatactcaaccgggtttgcgcggc
atcagttttggcaatttcctgcttaaaagggtcattgacgagctgttgcgcgagctcccg
cgtcttaaatcgtttgccaccctgtcacccataccaggctttgccgaatggttgggcaag
caagatggcaaagccttgcaggatctgcttaacgacaaggccgacaagcaacaggccctt
gatgatcccgaagcagggctcaagtgggtagacaggctcaagtcggcggcggccgggcag
gcttccgatgcggtccagcgcacgggtctgcggctggcggttcaatatctgaaaaccatg
aaaaatggtcagccgctggatcctgtggctcgctttcatctgggtaatggggcgcgcata
gagcgtgtcaactgggctgcagactgctctgccaaaggcatgacgcaatcttgcggagtc
atggccaattacctgtatgagctcgatcagctggacgataacctcgcccaactggccgct
ggaaaacccaggctgggaatgaacttgaggtggcgatga

DBGET integrated database retrieval system