KEGG   Pusillimonas sp. T7-7: PT7_0421Help
Entry
PT7_0421          CDS       T01486                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
put  Pusillimonas sp. T7-7
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PT7_0421
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PT7_0421
   00650 Butanoate metabolism
    PT7_0421
  Energy metabolism
   00190 Oxidative phosphorylation
    PT7_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488714..489094
Genome map
AA seq 126 aa AA seqDB search
MAQERIGVRRHVVGAHYGTLDFIAQRVTAIIMAVYTLVLLGGILFTPELNYEGWRGLFTF
TCLSLPVGQMLATLAFMSLVWHAWIGVRDIWMDYVRSAGLRLFLQVLTILWLVGALVYFA
KILWSL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagaacgcattggtgtacggcgtcatgtcgtcggcgcgcattacggcacactc
gacttcatcgcacagcgggttaccgccatcatcatggccgtttataccctggtgctgctt
gggggcattctgttcacgcccgagctcaactacgagggctggcgtggcttgttcacgttc
acctgtctgagcctgccggtggggcaaatgctggctacgctggcctttatgtcgctggtc
tggcatgcctggataggtgtgcgcgacatctggatggactacgttcgttcggctggcttg
cgcctgttcctgcaggttctgaccatcttgtggttggtcggcgcccttgtttatttcgca
aaaattctctggagtttataa

DBGET integrated database retrieval system