KEGG   Pusillimonas sp. T7-7: PT7_0430Help
Entry
PT7_0430          CDS       T01486                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
put  Pusillimonas sp. T7-7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PT7_0430
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PT7_0430
  Amino acid metabolism
   00310 Lysine degradation
    PT7_0430
Enzymes [BR:put01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PT7_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500719..501915
Genome map
AA seq 398 aa AA seqDB search
MAIIDVLVPQLSESITEATLLNWKKQPGEAIEADEILIEVETDKVVLEVPAPSAGVMKEI
VKGDGSTVTAGEVLARIDSEGKAAAPAAAAEESAAAAPAAAAAPSASAIASPAAGKILAE
KGVDPASVEGSGRDGRITKGDALQAGSAPAKKAAAPVAPASLSLDGRPEQRVPMSRLRAR
VAERLLQSQSDNAILTTFNEVNMQGILDLRKKYKDQFEKEHGVKLGFTSFFVKAAVAALK
KYPVVNASVDGKDIIYHGYFDIGIAVGSPRGLVVPILRNADQLSIAEIEKQIADFGARAR
DGKLGLEELTGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKERPVVENGQIVIRPI
NFLALSYDHRIIDGREAVLALVAMKEALEDPQRLLLDV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctattattgacgttctcgtaccccagctttccgagtccatcaccgaggctactctg
ctcaactggaagaaacaaccgggggaagcgatcgaagccgacgagatcctgatcgaggta
gaaactgacaaggtcgttcttgaagtgcccgcaccttcggcgggtgtgatgaaagaaatc
gttaaaggcgatggcagtactgtgactgccggcgaagttttggctcgtatcgactctgaa
ggcaaggctgcagcgccagcggctgccgcagaagagtcggcagccgccgccccagccgcc
gctgccgcaccgtctgcttcggccatcgcttcgcctgccgcaggcaagattttggccgaa
aaaggtgtagaccccgcatcggttgaaggctcgggccgggacggtcgtatcaccaagggc
gacgctcttcaggcaggtagtgcgccggccaagaaagcagctgctcccgtagctcctgct
tcgctttcgctcgacggtcgccccgagcagcgcgtacccatgagccgcctgcgcgcccgt
gtggccgagcggctgctgcaatcgcaatccgacaacgccattcttacgaccttcaacgaa
gtcaacatgcagggcattctggatctgcgcaagaaatacaaagaccagttcgaaaaagaa
cacggcgtcaagctgggtttcacttctttctttgtaaaggctgcagtggcagccctgaag
aagtaccccgttgtcaacgcatcggtcgatggcaaagacatcatctatcacggctacttc
gatattggtattgctgtgggcagtccgcgtggcctggttgtgcccatcctgcgtaacgca
gatcagctctccattgccgaaatcgaaaagcaaattgccgactttggtgcgcgcgcacgc
gacggcaagctgggtcttgaagaactgaccggcggtacgttctccatctccaatggcggt
gtgttcggctccatgctgtctacacccatcattaatcctccacagtcggcaattcttggc
attcatgccaccaaagagcgccctgtggtcgagaacggccaaatcgtcattcgccccatc
aacttccttgctttgtcatatgatcaccgtattattgacggtcgcgaggccgtgctggcc
ctggtcgccatgaaagaagcgcttgaagacccacaacgcctgttgctggatgtctaa

DBGET integrated database retrieval system