KEGG   Pusillimonas sp. T7-7: PT7_0491Help
Entry
PT7_0491          CDS       T01486                                 

Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
put  Pusillimonas sp. T7-7
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:put01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:put01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:put00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571147..571827
Genome map
AA seq 226 aa AA seqDB search
MLTQTELKQNVADAAVQFALPFLAPDVILGVGTGSTVDLFIDALAPYKDRFRAAVSSSER
SSARMASLGIQVLDLNQVSGMPLYIDGADEFDHALNMIKGGGGALTREKIVASVAQRFVC
IVDESKRVETLGHFPLPVEVIPMAREVVSRRLVELGGTPVLRRDFVTDNGCQILDVSGLR
ITAPVETEALINNIPGVVCCGLFALAGADIVLMSTQEGVRQFVKDA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcttacccaaacggaactcaaacagaatgtggctgatgcggccgtgcaattcgcgctg
ccgtttctggctcccgatgtcatcctgggggtcggcaccgggtcgacggtagaccttttc
attgatgccctggctccctataaagaccgttttcgtgctgctgtatccagctccgagcgc
agctcggcacgtatggcgtccctgggtattcaggttctcgatctgaaccaggtttcgggc
atgcccttgtatatcgatggggccgacgaattcgatcacgcgttgaatatgatcaagggc
ggaggcggcgcgctcacccgcgaaaaaattgttgcctcggtggcgcagcgttttgtatgc
attgttgatgaatcaaaaagagttgaaacactgggccactttcccctgccggtcgaagtc
ataccgatggcgcgcgaggttgtttcccggcgtctggtcgagctggggggcacacccgtg
ttaagacgtgatttcgtgacagacaatggctgccagatcctggacgtatcagggctccgt
attacagcaccggtcgaaacagaggcgttgatcaacaatattccaggcgtggtttgctgc
gggctttttgccctggccggtgccgacatcgtgctgatgtccactcaggaaggagtgcgt
cagttcgtcaaagacgcataa

DBGET integrated database retrieval system