KEGG   Pusillimonas sp. T7-7: PT7_0491Help
Entry
PT7_0491          CDS       T01486                                 

Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
put  Pusillimonas sp. T7-7
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PT7_0491
   01230 Biosynthesis of amino acids
    PT7_0491
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PT7_0491
Enzymes [BR:put01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PT7_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571147..571827
Genome map
AA seq 226 aa AA seqDB search
MLTQTELKQNVADAAVQFALPFLAPDVILGVGTGSTVDLFIDALAPYKDRFRAAVSSSER
SSARMASLGIQVLDLNQVSGMPLYIDGADEFDHALNMIKGGGGALTREKIVASVAQRFVC
IVDESKRVETLGHFPLPVEVIPMAREVVSRRLVELGGTPVLRRDFVTDNGCQILDVSGLR
ITAPVETEALINNIPGVVCCGLFALAGADIVLMSTQEGVRQFVKDA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcttacccaaacggaactcaaacagaatgtggctgatgcggccgtgcaattcgcgctg
ccgtttctggctcccgatgtcatcctgggggtcggcaccgggtcgacggtagaccttttc
attgatgccctggctccctataaagaccgttttcgtgctgctgtatccagctccgagcgc
agctcggcacgtatggcgtccctgggtattcaggttctcgatctgaaccaggtttcgggc
atgcccttgtatatcgatggggccgacgaattcgatcacgcgttgaatatgatcaagggc
ggaggcggcgcgctcacccgcgaaaaaattgttgcctcggtggcgcagcgttttgtatgc
attgttgatgaatcaaaaagagttgaaacactgggccactttcccctgccggtcgaagtc
ataccgatggcgcgcgaggttgtttcccggcgtctggtcgagctggggggcacacccgtg
ttaagacgtgatttcgtgacagacaatggctgccagatcctggacgtatcagggctccgt
attacagcaccggtcgaaacagaggcgttgatcaacaatattccaggcgtggtttgctgc
gggctttttgccctggccggtgccgacatcgtgctgatgtccactcaggaaggagtgcgt
cagttcgtcaaagacgcataa

DBGET integrated database retrieval system