KEGG   Pusillimonas sp. T7-7: PT7_0546Help
Entry
PT7_0546          CDS       T01486                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:put00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(636221..637759)
Genome map
AA seq 512 aa AA seqDB search
MLARTLQISDIFRAAMTYLLALDQGTSSTRSIVFDQQGNIVALAQKEIAQIYPEPGWVEH
DPMEIWHTQLSTAQEAIAKAGLKASDIHAIGITNQRETTVVWNKKTGTPIYNAIVWQDRR
AEPTCAILREQGLDGVILEKTGLRVDAYFSGTKLKWILDHVPDARKQAAKGELAFGTIDS
WLMWQLTQGDKHVSDVSNASRTMLFNVHSNEWDAELLQMLDIPPALLPKVQPSGSEFGAV
AADLLGHAIPICGVAGDQQSALFGQACFTEGMAKNTYGTGCFMLMHTGSTFQISQNGLVT
TSAAQTSSQPLYALEGSVFVAGAVVQWMRDGLHAFKKSSEIEALAQSVPDSGGVMLVPAF
TGLGAPYWKPDARGAITGLTRGTTMAHIARAALESIAYQSAALLQAMSRDSVAAGSAPLA
ELRVDGGACVNDLLMQFQADLLGIPVLRPTMIETTALGAAYLAGLTSGVYRDSQELSALW
NVERRFTPQMSKAEAQALMDGWEHAVRQTCAD
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgtacactccagatcagcgatatattcagggccgccatgacttacctactt
gcacttgaccaaggcacttccagcacacgcagcattgttttcgaccaacaaggaaacatc
gtggcgctggcgcaaaaggaaatcgcgcaaatctatcccgagccgggctgggtcgagcac
gatcccatggaaatctggcacacccagctgagcactgcccaggaagccattgccaaggcc
gggctaaaggccagcgacatacacgccatcggcattaccaaccagcgtgaaaccaccgtc
gtctggaacaagaaaacaggtacgcccatatataatgccatcgtctggcaagaccggcgt
gccgagcccacgtgcgccatactgcgggagcaaggccttgacggcgtcatcctggaaaaa
accggtttgcgtgtcgacgcttatttttcaggcaccaagctcaaatggatactggaccac
gtccctgatgcgcgcaagcaggccgccaaaggcgaacttgcctttggcacgatagacagc
tggctgatgtggcagctgacccagggcgacaagcacgtcagcgatgtcagcaatgcctcg
cgcaccatgctgttcaatgtccacagcaatgaatgggatgccgagctgctgcaaatgctg
gacatcccgcctgcccttctgcccaaagtgcagccgtcaggctccgagtttggggcggtt
gccgccgacctgcttggtcatgccattccgatatgcggcgtcgccggcgatcagcaaagc
gccttgttcgggcaggcatgctttaccgagggcatggccaagaacacctacggcacagga
tgcttcatgctgatgcacaccggctcgacttttcagatttcacagaacggcctggtcacc
accagcgcggcacaaaccagtagccagcccctgtacgcgctggagggcagtgtatttgtg
gcgggcgccgtggtgcagtggatgcgtgatggcctgcatgccttcaagaaaagcagcgaa
atcgaagcattggcgcaaagcgtacccgactcgggcggagtcatgctggtgccggcattc
acaggcctgggcgccccctactggaagccggatgcccggggcgcgatcaccggtctgacg
cgtggcaccaccatggcacacatagcgcgggctgcgttggaaagcattgcctatcaaagc
gcagccttgttgcaagccatgagccgggactctgtcgcagcgggctcggcgccgttggcc
gagctgcgtgttgatggcggcgcctgcgttaatgatctgttgatgcagttccaggctgac
ctgcttggcattccggtgctcaggcccaccatgatagaaaccactgcgctgggcgccgcc
tacttggccggcctgaccagcggcgtttaccgcgatagccaggaattgtcggccctttgg
aatgtagagcgccgcttcacgccacagatgtccaaggccgaggcccaggcattgatggac
ggctgggagcacgccgtgcgtcagacctgcgccgactag

DBGET integrated database retrieval system