KEGG   Pusillimonas sp. T7-7: PT7_0985Help
Entry
PT7_0985          CDS       T01486                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
put  Pusillimonas sp. T7-7
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PT7_0985
Enzymes [BR:put01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PT7_0985
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PT7_0985
Lipid biosynthesis proteins [BR:put01004]
 Fatty acid synthase
  Component type
   PT7_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1091039..1091692)
Genome map
AA seq 217 aa AA seqDB search
MWIRRSFAVVALCCFQFAGSLAWASPQHTSPESTILVLGDSLSAEYGLRRGSGWVSVIEQ
RLSEQNPTYQIHNSSISGDTTSGGLSRLPAALEQYQPGIVIIELGANDALRGLSLSMTEK
NLADMIELSQQANARVLLLGMQIPPNYGRKYTEQFQNLYPMLAERHNTQLTPFLLDGIAA
DRSRFQADGIHPNEEAQSVLAENVWEQLAPMLQAHGK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtggatacgccgtagttttgcagtcgttgcactgtgttgttttcagtttgcaggcagc
ttggcctgggccagcccacagcataccagccccgagtccaccatactggtgctgggcgac
agtctttctgctgaatacgggctgcggcgcggttccggctgggtatccgtcatcgagcaa
cgcctgagcgaacagaatccaacctaccaaatacacaacagcagcataagcggcgacacc
accagcggtggccttagccgccttcctgctgcgcttgagcaataccagcccggtattgtg
atcattgaactgggcgccaatgatgccctgaggggcctgtctctgagcatgacagaaaaa
aatctggctgacatgattgagctgtcgcagcaagccaatgcgcgggtacttttgctgggg
atgcaaataccgcccaattacggccgcaagtacaccgagcaattccagaatttataccct
atgctggccgagcggcacaacacgcagctgaccccgttcttattagatggcattgctgcc
gaccgcagccggtttcaggcagacggcatacaccccaacgaagaggcgcagtcagtgctt
gccgaaaacgtatgggaacaattggcgcccatgctgcaagcgcatggcaaataa

DBGET integrated database retrieval system