KEGG   Pusillimonas sp. T7-7: PT7_0993Help
Entry
PT7_0993          CDS       T01486                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00230  Purine metabolism
put01100  Metabolic pathways
Module
put_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PT7_0993
Enzymes [BR:put01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PT7_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 AAA_16 Dynamin_N AAA_18 ABC_tran AAA_22
Motif
Other DBs
NCBI-ProteinID: AEC19533
UniProt: F4GRH4
Position
complement(1098790..1099398)
Genome map
AA seq 202 aa AA seqDB search
MVVAPSGAGKSSLVNALLAEDPTLVLSISCTTRKARPGEEADKHYRFVSHEQFKALQEQN
ALLEWAEVHGNFYGTPRDRIDAALNQGQDVLLEIDWQGARQVREHFPQAVGIFILPPSIE
ALELRLTKRGQDAPQVISRRLLAAGSEMSHASECQYVIINQEFSLALQQLAQIVAATRLR
YPAQAQRHTELFSQLGISKTVA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggcccccagcggcgcaggcaaatccagcctggtcaatgccctgctggccgaa
gatcccactctggtgctgtctatatcatgcaccacccgcaaggcccgtcccggcgaagaa
gccgacaagcactatcgcttcgtcagccatgagcagttcaaggcactgcaagaacagaat
gccttgctggaatgggccgaggtgcatggaaacttctacggcacaccccgtgaccgcatc
gatgctgcgctcaaccagggccaggacgttctgctggaaattgactggcaaggcgcacgc
caggtgcgcgagcattttccccaagcggttggtatttttattttgcctccgtccatcgag
gctctggagctgcgtctgaccaagcgcggacaagacgcgcctcaggtcatttcccgtcgt
ctgttggctgcgggaagcgaaatgtcgcatgcttcagagtgtcaatatgttattattaat
caagaatttagcttggcattgcagcaactggcgcaaattgttgccgccacacgcctgcgt
taccctgctcaagcgcagcgccacacagaactcttttcacaactaggcatcagcaaaact
gttgcctga

DBGET integrated database retrieval system