KEGG   Pusillimonas sp. T7-7: PT7_1017Help
Entry
PT7_1017          CDS       T01486                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:put01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:put00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:put00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:put00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125428..1127146
Genome map
AA seq 572 aa AA seqDB search
MNMSNTIEVKVPDIGDFSEVEIIEVLVSEGDTIAAEQSLITVESDKASMEIPSPQAGVVK
SVAVKVGDRVKEGSVILQVEMQGAGADGAKDKPAAAESKPAAAEPSKQQDAPAQDGKAAS
QAQQGGERVTIVVPDIGDANDVEVIEIMVAVGDTVSKEQSLITVESDKASMEVPASHAGV
VTAVKVKLGDKVNQGSEIIEVQASEGQAAAPAEKPAAQAQQEAPAAKPEQVSTVISPAPA
KDGGMASVPPERHSPTEAYAQADVPLRNLPHASPSVRKFARELGVNLAAVTGSGAKNRIT
KEDVQQYVKGALAVGGGTAVSAAAAGEGGLSVLGWPKVDFGKFGSIETKPLSRIKKISGA
NLHRNWVMIPHVTNNDVADITELEDLRQTLNKENQKSGVKVTMLAFLIKAVVAGLKKFPE
FNASIDGDNLVLKQYYHIGFAADTPNGLVVPVIRDADKKGIFELATETSELAKLARDGKL
SPGQMQGGCFSISSLGGIGGTSFTPIINAPEVAILGVSRSTHAPVWNGKEFEPRLMLPLS
LSYDHRVIDGAAAARFNAYLGNLLADFRRIAL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgagcaataccatcgaagttaaagtcccggacatcggcgacttcagcgaggtc
gagatcatcgaggttttggtgtctgaaggcgatacgattgccgcagagcaaagcctgatc
accgtcgagtctgacaaggcctccatggaaatcccgtcccctcaggcaggggtggtcaag
tcggtggctgtcaaggtgggcgacagggtcaaggaaggttcagtcattctgcaagtcgaa
atgcagggtgcgggcgccgacggcgcaaaagacaaaccggccgcagcggaaagcaaaccc
gccgcagccgaaccaagcaagcaacaagatgcgcccgcccaagatggcaaggcagcttcg
caggctcagcaaggcggtgagcgggtcactattgtcgtacccgatatcggcgatgccaac
gacgtcgaagtgatagaaatcatggttgcggtaggcgataccgtcagcaaagagcaaagc
ctcattactgtcgagtccgacaaggcttccatggaggttccggcttcgcatgcgggcgtg
gtcactgccgtaaaggtgaagctgggcgacaaggtcaaccagggttcggaaatcatcgaa
gtgcaggccagcgaaggccaggcagccgcacccgccgagaaacccgccgctcaggcgcag
caggaagcgcctgccgccaagccggaacaggtttccacggtcatcagcccggccccggct
aaggacggcggcatggcctcagtccctcccgagcgccattcgcccactgaagcctatgcc
caagctgatgtgcctctgcgtaatttgccgcatgcttcgccttcggtgcgtaaattcgca
cgcgaattgggtgtcaacctggccgctgtaaccggctcgggcgccaagaaccgtattacc
aaggaagatgtccagcagtacgtcaagggagcgctggcggtgggcggcggaacggctgtt
tcggcagctgccgcaggcgagggcggtttgagcgtgctggggtggcccaaggtcgacttt
ggcaagttcggttccattgaaaccaagccgttgtcgcgcatcaaaaagatttccggcgcc
aatctgcaccgcaactgggtcatgattccccacgtcaccaataacgacgtggccgacatc
accgaactcgaagatttgcgtcaaacgttgaacaaagaaaatcagaagtcgggcgtcaag
gtaaccatgctggcctttctgatcaaggcggtggttgccgggctcaagaaatttcctgaa
ttcaatgcgtccatcgacggcgataatctggtcttgaagcagtactaccatatcggcttt
gccgccgatacacccaacgggttggtggtgccggttattcgagatgccgacaaaaagggt
attttcgagttggcgaccgagacctcggagctggccaagctggcacgcgacggcaagctc
tcacccggccagatgcaaggcggatgcttctcaatttcttcgctgggcggcataggcggc
acctcgtttacaccgattatcaatgcgcctgaagtcgccattctcggtgtgtcgcgttcc
actcatgcaccggtctggaatggcaaggaatttgaaccgcgcctcatgttgcctttgtcg
ttgtcgtacgaccaccgggtcattgacggcgccgctgcagcccgcttcaacgcctatctg
ggcaatttgctggccgacttccgtcgtatcgcgctatag

DBGET integrated database retrieval system