KEGG   Pusillimonas sp. T7-7: PT7_1032Help
Entry
PT7_1032          CDS       T01486                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00900  Terpenoid backbone biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PT7_1032
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PT7_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEC19572
UniProt: F4GS22
Position
1142265..1143467
Genome map
AA seq 400 aa AA seqDB search
MKFQQLCVLGSTGSIGENTLDVVLRHPETMAVYALSAYSRIEELAEQALITKAKVVVVPT
EQARARFRQAWAGSGAGPEIRIGAQALVDTVLDTEVTTVMAAIVGAAGLPSALAAAQAGK
RVLLANKEALVAAGGLFMRTVRENGAELLPIDSEHNAIFQCMPQTGRATAPTKPAAGVRR
LLLTASGGPFRTTALDKLAGVTPDQACAHPNWSMGRKISVDSATMLNKGLEVIEAHWLFA
MPVQRIQVVIHPQSMVHSMVEYEDGSILAQLGQPDMRTPIAYGLGFPERISSGVGLLELT
TLGRLDFEEPNFERFPCLRLSFDALKTGQAACVALNAANEIAVDCFLKQQIRYTEIASVI
ETCLERVTGLPHTALDSLDEVLALDAHTRGIAAELCLLKA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcaacagctatgtgtgctgggatccaccggctccataggagaaaacacactg
gacgtggtgctgcgccaccccgagaccatggcggtgtatgcattgagtgcatacagccgc
atagaagagcttgccgagcaggccctgataacgaaagccaaagtcgttgtggtgcctacc
gagcaggcgcgcgcacgctttcgtcaggcttgggccggcagcggagcgggtccggaaatc
cggattggcgcccaggccctggtcgatacagtgctcgataccgaggtgaccaccgtgatg
gcagccatcgtaggggcggcaggcctgccttcggccctggctgcggcccaggccggcaaa
cgggtgctgctggccaataaagaagcgctggtggctgcaggcggtctgtttatgcgtacg
gtgcgtgaaaacggcgccgaactgctgcctatcgacagcgagcacaatgcgatttttcag
tgcatgccgcaaacgggcagggcgactgcgccgaccaagccagcggcgggcgtaaggcgc
ttgctgcttacggcctctggcgggcctttccgcactactgcccttgataagctggcgggt
gtcacgcccgatcaggcctgtgcgcatcccaactggagcatgggccgcaaaatctcggtc
gattccgccactatgctcaataaaggtctggaagttatcgaggcgcattggctgtttgcc
atgccggttcagcgcatacaagtcgtcattcacccgcaaagcatggtgcattccatggtc
gagtacgaagacggctcgatactggcgcaactgggccagcccgatatgcgtacccccatt
gcctacggccttggctttcctgagcgcatatccagcggagtgggcttgctggaactgacc
acgctggggcgactcgacttcgaagaacccaatttcgagcgttttccctgtctgcggctt
tccttcgatgcgctcaagacagggcaggcggcctgcgtcgcgcttaatgccgccaacgag
attgcggtagattgttttttaaagcagcaaattcgctatactgaaatcgcatccgtcatc
gaaacctgtctggagcgggttacaggccttccacacacggctctcgactcgctggacgag
gttctggcgctggatgcacacacacgcggcatcgctgcagagctatgcctgctcaaggcc
tga

DBGET integrated database retrieval system