KEGG   Pusillimonas sp. T7-7: PT7_1064Help
Entry
PT7_1064          CDS       T01486                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
put  Pusillimonas sp. T7-7
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:put00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PT7_1064
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PT7_1064
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PT7_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1176689..1177183)
Genome map
AA seq 164 aa AA seqDB search
MTSVYAFSAVALDGETIDFSRYQGKVLLIVNVASECGFTPQYEGLEALYQSYRDQGFVVL
GFPCNQFGHQEPGDSAQIASFCTQQYGVTFPLFEKIEVNGPGSHPLYAWLKTEKSGVLGS
QSIKWNFTKFLLGRDGQVLQRYGSTTKPGAMRRDIEKALEKGNT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggtgtatgccttttccgcggttgcgcttgatggcgaaaccatagacttttcc
cgctatcagggcaaggtcctgttgatcgtgaatgtagcgtcggaatgtggcttcacgccg
caatacgagggtctggaagcactctatcaaagctatcgcgaccagggcttcgtcgtgctt
ggtttcccctgcaatcagtttggccatcaggagccgggcgactccgcgcagatcgccagc
ttctgcacacaacagtatggcgtcacattcccattgtttgaaaaaatagaggtcaacggc
cctggttcccaccctctgtatgcctggctcaagacggaaaaatccggcgtgctgggaagc
cagagcatcaagtggaatttcaccaagttcctgctcggccgcgatggccaggtcttgcag
cgctatggctccaccaccaagcccggagcgatgcgccgcgatattgaaaaggcactcgaa
aaaggaaacacatga

DBGET integrated database retrieval system